PDB entry 1weg

View 1weg on RCSB PDB site
Description: Catalytic Domain Of Muty From Escherichia Coli K142A Mutant
Class: hydrolase
Keywords: hydrolase
Deposited on 2004-05-25, released 2004-09-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-08-20, with a file datestamp of 2014-08-15.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.2
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: A/G-specific adenine glycosylase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17802 (0-224)
      • engineered (141)
    Domains in SCOPe 2.08: d1wega_
  • Heterogens: EDO, IMD, SF4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wegA (A:)
    mqasqfsaqvldwydkygrktlpwqidktpykvwlsevmlqqtqvatvipyferfmarfp
    tvtdlanapldevlhlwtglgyyararnlhkaaqqvatlhggkfpetfeevaalpgvgrs
    tagailslslgkhfpildgnvarvlarcyavsgwpgkkevenklwslseqvtpavgverf
    nqammdlgamictrskpkcslcplqngciaaannswalypgkkpk