PDB entry 1wef

View 1wef on RCSB PDB site
Description: Catalytic Domain Of Muty From Escherichia Coli K20A Mutant
Class: hydrolase
Keywords: hydrolase
Deposited on 2004-05-25, released 2004-09-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.2
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: A/G-specific adenine glycosylase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17802 (0-224)
      • engineered (19)
    Domains in SCOPe 2.07: d1wefa_
  • Heterogens: SF4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1wefA (A:)
mqasqfsaqvldwydkygratlpwqidktpykvwlsevmlqqtqvatvipyferfmarfp
tvtdlanapldevlhlwtglgyyararnlhkaaqqvatlhggkfpetfeevaalpgvgrs
tagailslslgkhfpildgnvkrvlarcyavsgwpgkkevenklwslseqvtpavgverf
nqammdlgamictrskpkcslcplqngciaaannswalypgkkpk