PDB entry 1wee

View 1wee on RCSB PDB site
Description: Solution structure of PHD domain in PHD finger family protein
Class: DNA binding protein
Keywords: NMR, structural genomics, PHD domain, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2004-05-24, released 2004-11-24
The last revision prior to the SCOP 1.75 freeze date was dated 2004-11-24, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: PHD finger family protein
  Species: Arabidopsis thaliana
  Gene: RAFL09-15-N01
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9C810 (7-65)
    • cloning artifact (0-6)
    • cloning artifact (66-71)
  Domains in SCOP 1.75: d1weea_
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1weeA (A:)
  gssgssgmergvdnwkvdckcgtkdddgermlacdgcgvwhhtrciginnadalpskflc
  frcielsgpssg