PDB entry 1wee

View 1wee on RCSB PDB site
Description: Solution structure of PHD domain in PHD finger family protein
Class: DNA binding protein
Keywords: NMR, structural genomics, PHD domain, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2004-05-24, released 2004-11-24
The last revision prior to the SCOP 1.73 freeze date was dated 2004-11-24, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PHD finger family protein
    Species: Arabidopsis thaliana
    Gene: RAFL09-15-N01
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9C810 (7-65)
      • cloning artifact (0-6)
      • cloning artifact (66-71)
    Domains in SCOP 1.73: d1weea_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1weeA (A:)
    gssgssgmergvdnwkvdckcgtkdddgermlacdgcgvwhhtrciginnadalpskflc
    frcielsgpssg