PDB entry 1wee

View 1wee on RCSB PDB site
Description: Solution structure of PHD domain in PHD finger family protein
Class: DNA binding protein
Keywords: NMR, structural genomics, PHD domain, RIKEN Structural Genomics/Proteomics Initiative, RSGI, DNA BINDING PROTEIN
Deposited on 2004-05-24, released 2004-11-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PHD finger family protein
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: RAFL09-15-N01
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9C810 (7-65)
      • cloning artifact (0-6)
      • cloning artifact (66-71)
    Domains in SCOPe 2.08: d1weea1, d1weea2, d1weea3
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1weeA (A:)
    gssgssgmergvdnwkvdckcgtkdddgermlacdgcgvwhhtrciginnadalpskflc
    frcielsgpssg