PDB entry 1wec

View 1wec on RCSB PDB site
Description: acid proteinase (penicillopepsin) (e.c.3.4.23.20) complex with phosphonate inhibitor: methyl (2s)-[1-(((n-(1-naphthaleneacetyl))-l-valyl)aminomethyl) hydroxyphosphinyloxy]-3-phenylpropanoate, sodium salt
Deposited on 1997-07-08, released 1998-01-14
The last revision was dated 1998-01-14, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.161
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    no info in PDB for this chain
  • Chain 'p':
    no info in PDB for this chain
  • Heterogens: MAN, SO4, PP5, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records:
    >1wec_ (-)
    aasgvatntptandeeyitpvtiggttlnlnfdtgsadlwvfstelpasqqsghsvynps
    atgkelsgytwsisygdgssasgnvftdsvtvggvtahgqavqaaqqisaqfqqdtnndg
    llglafssintvepqsqttffdtvksslaqplfavalkhqqpgvydfgfidsskytgslt
    ytgvdnsqgfwsfnvdsytagsqsgdgfsgiadtgttllllddsvvsqyysqvsgaqqds
    naggyvfdcstnlpdfsvsisgytatvpgslinygpsgdgstclggiqsnsgigfsifgd
    iflksqyvvfdsagpqlgfapqa
    

  • Chain 'p':
    No sequence available.