PDB entry 1we8

View 1we8 on RCSB PDB site
Description: Solution structure of KH domain in protein BAB28342
Class: RNA binding protein
Keywords: NMR, structural genomics, KH domain, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2004-05-24, released 2004-11-24
The last revision prior to the SCOP 1.73 freeze date was dated 2004-11-24, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Tudor and KH domain containing protein
  Species: MUS MUSCULUS
  Gene: RIKEN cDNA 2700091C21
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q80VL1 (7-97)
    • cloning artifact (0-6)
    • cloning artifact (98-103)
  Domains in SCOP 1.73: d1we8a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1we8A (A:)
  gssgssgiltentpvfeqlsvpqrsvgriigrggetirsickasgakitcdkesegtlll
  srlikisgtqkevaaakhlilekvsedeelrkriahsasgpssg