PDB entry 1we8

View 1we8 on RCSB PDB site
Description: Solution structure of KH domain in protein BAB28342
Deposited on 2004-05-24, released 2004-11-24
The last revision prior to the SCOP 1.71 freeze date was dated 2004-11-24, with a file datestamp of 2004-11-24.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1we8a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1we8A (A:)
    gssgssgiltentpvfeqlsvpqrsvgriigrggetirsickasgakitcdkesegtlll
    srlikisgtqkevaaakhlilekvsedeelrkriahsasgpssg