PDB entry 1we8

View 1we8 on RCSB PDB site
Description: Solution structure of KH domain in protein BAB28342
Class: RNA binding protein
Keywords: NMR, structural genomics, KH domain, RIKEN Structural Genomics/Proteomics Initiative, RSGI, RNA BINDING PROTEIN
Deposited on 2004-05-24, released 2004-11-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Tudor and KH domain containing protein
  Species: Mus musculus [TaxId:10090]
  Gene: RIKEN cDNA 2700091C21
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q80VL1 (7-97)
    • cloning artifact (0-6)
    • cloning artifact (98-103)
  Domains in SCOPe 2.08: d1we8a1, d1we8a2, d1we8a3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1we8A (A:)
  gssgssgiltentpvfeqlsvpqrsvgriigrggetirsickasgakitcdkesegtlll
  srlikisgtqkevaaakhlilekvsedeelrkriahsasgpssg