PDB entry 1we6

View 1we6 on RCSB PDB site
Description: Solution structure of Ubiquitin-like domain in splicing factor AAL91182
Class: gene regulation
Keywords: NMR, structural genomics, Ubiquitin-like domain, splicing factor, RIKEN Structural Genomics/Proteomics Initiative, RSGI, GENE REGULATION
Deposited on 2004-05-24, released 2004-11-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: splicing factor, putative
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: RAFL06-12-F22
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8RXF1 (7-104)
      • cloning artifact (0-6)
      • cloning artifact (105-110)
    Domains in SCOPe 2.08: d1we6a1, d1we6a2, d1we6a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1we6A (A:)
    gssgssgkfdesalvpedqflaqhpgpatirvskpnendgqfmeitvqslsenvgslkek
    iageiqipankqklsgkagflkdnmslahynvgageiltlslrersgpssg