PDB entry 1we5

View 1we5 on RCSB PDB site
Description: Crystal Structure of Alpha-Xylosidase from Escherichia coli
Class: hydrolase
Keywords: TIM BARREL, Glycoside Hydrolase, GH family 31
Deposited on 2004-05-24, released 2005-02-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.205
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative family 31 glucosidase yicI
    Species: Escherichia coli [TaxId:562]
    Gene: yicI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31434 (0-771)
      • modified residue (0)
      • modified residue (31)
      • modified residue (149)
      • modified residue (200)
      • modified residue (292)
      • modified residue (309)
      • modified residue (330)
      • modified residue (407)
      • modified residue (435)
      • modified residue (489)
      • modified residue (568-569)
      • modified residue (586-587)
      • modified residue (590-592)
      • modified residue (608)
      • modified residue (614)
    Domains in SCOPe 2.06: d1we5a1, d1we5a2, d1we5a3, d1we5a4
  • Chain 'B':
    Compound: Putative family 31 glucosidase yicI
    Species: Escherichia coli [TaxId:562]
    Gene: yicI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31434 (0-771)
      • modified residue (0)
      • modified residue (31)
      • modified residue (149)
      • modified residue (200)
      • modified residue (292)
      • modified residue (309)
      • modified residue (330)
      • modified residue (407)
      • modified residue (435)
      • modified residue (489)
      • modified residue (568-569)
      • modified residue (586-587)
      • modified residue (590-592)
      • modified residue (608)
      • modified residue (614)
    Domains in SCOPe 2.06: d1we5b1, d1we5b2, d1we5b3, d1we5b4
  • Chain 'C':
    Compound: Putative family 31 glucosidase yicI
    Species: Escherichia coli [TaxId:562]
    Gene: yicI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31434 (0-771)
      • modified residue (0)
      • modified residue (31)
      • modified residue (149)
      • modified residue (200)
      • modified residue (292)
      • modified residue (309)
      • modified residue (330)
      • modified residue (407)
      • modified residue (435)
      • modified residue (489)
      • modified residue (568-569)
      • modified residue (586-587)
      • modified residue (590-592)
      • modified residue (608)
      • modified residue (614)
    Domains in SCOPe 2.06: d1we5c1, d1we5c2, d1we5c3, d1we5c4
  • Chain 'D':
    Compound: Putative family 31 glucosidase yicI
    Species: Escherichia coli [TaxId:562]
    Gene: yicI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31434 (0-771)
      • modified residue (0)
      • modified residue (31)
      • modified residue (149)
      • modified residue (200)
      • modified residue (292)
      • modified residue (309)
      • modified residue (330)
      • modified residue (407)
      • modified residue (435)
      • modified residue (489)
      • modified residue (568-569)
      • modified residue (586-587)
      • modified residue (590-592)
      • modified residue (608)
      • modified residue (614)
    Domains in SCOPe 2.06: d1we5d1, d1we5d2, d1we5d3, d1we5d4
  • Chain 'E':
    Compound: Putative family 31 glucosidase yicI
    Species: Escherichia coli [TaxId:562]
    Gene: yicI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31434 (0-771)
      • modified residue (0)
      • modified residue (31)
      • modified residue (149)
      • modified residue (200)
      • modified residue (292)
      • modified residue (309)
      • modified residue (330)
      • modified residue (407)
      • modified residue (435)
      • modified residue (489)
      • modified residue (568-569)
      • modified residue (586-587)
      • modified residue (590-592)
      • modified residue (608)
      • modified residue (614)
    Domains in SCOPe 2.06: d1we5e1, d1we5e2, d1we5e3, d1we5e4
  • Chain 'F':
    Compound: Putative family 31 glucosidase yicI
    Species: Escherichia coli [TaxId:562]
    Gene: yicI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31434 (0-771)
      • modified residue (0)
      • modified residue (31)
      • modified residue (149)
      • modified residue (200)
      • modified residue (292)
      • modified residue (309)
      • modified residue (330)
      • modified residue (407)
      • modified residue (435)
      • modified residue (489)
      • modified residue (568-569)
      • modified residue (586-587)
      • modified residue (590-592)
      • modified residue (608)
      • modified residue (614)
    Domains in SCOPe 2.06: d1we5f1, d1we5f2, d1we5f3, d1we5f4
  • Heterogens: MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1we5A (A:)
    mkisdgnwliqpglnlihplqvfeveqqdnemvvyaaprdvrertwqldtplftlrffsp
    qegivgvriehfqgalnngphyplnilqdvkvtienteryaefksgnlsarvskgefwsl
    dflrngeritgsqvknngyvqdtnnqrnymferldlgvgetvyglgerftalvrngqtve
    twnrdggtsteqayknipfymtnrgygvlvnhpqcvsfevgsekvskvqfsveseyleyf
    vidgptpkavldrytrftgrpalppawsfglwlttsfttnydeatvnsfidgmaernlpl
    hvfhfdcfwmkafqwcdfewdpltfpdpegmirrlkakglkicvwinpyigqkspvfkel
    qekgyllkrpdgslwqwdkwqpglaiydftnpdackwyadklkglvamgvdcfktdfger
    iptdvqwfdgsdpqkmhnhyayiynelvwnvlkdtvgeeeavlfarsasvgaqkfpvhwg
    gdcyanyesmaeslrgglsiglsgfgfwshdiggfentapahvykrwcafgllsshsrlh
    gsksyrvpwayddescdvvrfftqlkcrmmpylyreaaranargtpmmrammmefpddpa
    cdyldrqymlgdnvmvapvfteagdvqfylpegrwthlwhndeldgsrwhkqqhgflslp
    vyvrdntllalgnndqrpdyvwhegtafhlfnlqdgheavcevpaadgsviftlkaartg
    ntitvtgageaknwtlclrnvvkvnglqdgsqaeseqglvvkpqgnaltitl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1we5B (B:)
    mkisdgnwliqpglnlihplqvfeveqqdnemvvyaaprdvrertwqldtplftlrffsp
    qegivgvriehfqgalnngphyplnilqdvkvtienteryaefksgnlsarvskgefwsl
    dflrngeritgsqvknngyvqdtnnqrnymferldlgvgetvyglgerftalvrngqtve
    twnrdggtsteqayknipfymtnrgygvlvnhpqcvsfevgsekvskvqfsveseyleyf
    vidgptpkavldrytrftgrpalppawsfglwlttsfttnydeatvnsfidgmaernlpl
    hvfhfdcfwmkafqwcdfewdpltfpdpegmirrlkakglkicvwinpyigqkspvfkel
    qekgyllkrpdgslwqwdkwqpglaiydftnpdackwyadklkglvamgvdcfktdfger
    iptdvqwfdgsdpqkmhnhyayiynelvwnvlkdtvgeeeavlfarsasvgaqkfpvhwg
    gdcyanyesmaeslrgglsiglsgfgfwshdiggfentapahvykrwcafgllsshsrlh
    gsksyrvpwayddescdvvrfftqlkcrmmpylyreaaranargtpmmrammmefpddpa
    cdyldrqymlgdnvmvapvfteagdvqfylpegrwthlwhndeldgsrwhkqqhgflslp
    vyvrdntllalgnndqrpdyvwhegtafhlfnlqdgheavcevpaadgsviftlkaartg
    ntitvtgageaknwtlclrnvvkvnglqdgsqaeseqglvvkpqgnaltitl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1we5B (B:)
    mkisdgnwliqpglnlihplqvfeveqqdnemvvyaaprdvrertwqldtplftlrffsp
    qegivgvriehfqgalnngphyplnilqdvkvtienteryaefksgnlsarvskgefwsl
    dflrngeritgsqvknngyvqdtnnqrnymferldlgvgetvyglgerftalvrngqtve
    twnrdggtsteqayknipfymtnrgygvlvnhpqcvsfevgsekvskvqfsveseyleyf
    vidgptpkavldrytrftgrpalppawsfglwlttsfttnydeatvnsfidgmaernlpl
    hvfhfdcfwmkafqwcdfewdpltfpdpegmirrlkakglkicvwinpyigqkspvfkel
    qekgyllkrpdgslwqwdkwqpglaiydftnpdackwyadklkglvamgvdcfktdfger
    iptdvqwfdgsdpqkmhnhyayiynelvwnvlkdtvgeeeavlfarsasvgaqkfpvhwg
    gdcyanyesmaeslrgglsiglsgfgfwshdiggfentapahvykrwcafgllsshsrlh
    descdvvrfftqlkcrmmpylyreaaranargtpmmrammmefpddpacdyldrqymlgd
    nvmvapvfteagdvqfylpegrwthlwhndeldgsrwhkqqhgflslpvyvrdntllalg
    nndqrpdyvwhegtafhlfnlqdgheavcevpaadgsviftlkaartgntitvtgageak
    nwtlclrnvvkvnglqdgsqaeseqglvvkpqgnaltitl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1we5C (C:)
    mkisdgnwliqpglnlihplqvfeveqqdnemvvyaaprdvrertwqldtplftlrffsp
    qegivgvriehfqgalnngphyplnilqdvkvtienteryaefksgnlsarvskgefwsl
    dflrngeritgsqvknngyvqdtnnqrnymferldlgvgetvyglgerftalvrngqtve
    twnrdggtsteqayknipfymtnrgygvlvnhpqcvsfevgsekvskvqfsveseyleyf
    vidgptpkavldrytrftgrpalppawsfglwlttsfttnydeatvnsfidgmaernlpl
    hvfhfdcfwmkafqwcdfewdpltfpdpegmirrlkakglkicvwinpyigqkspvfkel
    qekgyllkrpdgslwqwdkwqpglaiydftnpdackwyadklkglvamgvdcfktdfger
    iptdvqwfdgsdpqkmhnhyayiynelvwnvlkdtvgeeeavlfarsasvgaqkfpvhwg
    gdcyanyesmaeslrgglsiglsgfgfwshdiggfentapahvykrwcafgllsshsrlh
    gsksyrvpwayddescdvvrfftqlkcrmmpylyreaaranargtpmmrammmefpddpa
    cdyldrqymlgdnvmvapvfteagdvqfylpegrwthlwhndeldgsrwhkqqhgflslp
    vyvrdntllalgnndqrpdyvwhegtafhlfnlqdgheavcevpaadgsviftlkaartg
    ntitvtgageaknwtlclrnvvkvnglqdgsqaeseqglvvkpqgnaltitl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1we5C (C:)
    mkisdgnwliqpglnlihplqvfeveqqdnemvvyaaprdvrertwqldtplftlrffsp
    qegivgvriehfqgalnngphyplnilqdvkvtienteryaefksgnlsarvskgefwsl
    dflrngeritgsqvknngyvqdtnnqrnymferldlgvgetvyglgerftalvrngqtve
    twnrdggtsteqayknipfymtnrgygvlvnhpqcvsfevgsekvskvqfsveseyleyf
    vidgptpkavldrytrftgrpalppawsfglwlttsfttnydeatvnsfidgmaernlpl
    hvfhfdcfwmkafqwcdfewdpltfpdpegmirrlkakglkicvwinpyigqkspvfkel
    qekgyllkrpdgslwqwdkwqpglaiydftnpdackwyadklkglvamgvdcfktdfger
    iptdvqwfdgsdpqkmhnhyayiynelvwnvlkdtvgeeeavlfarsasvgaqkfpvhwg
    gdcyanyesmaeslrgglsiglsgfgfwshdintapahvykrwcafgllsshsrlhdesc
    dvvrfftqlkcrmmpylyreaaranargtpmmrammmefpddpacdyldrqymlgdnvmv
    apvfteagdvqfylpegrwthlwhndeldgsrwhkqqhgflslpvyvrdntllalgnndq
    rpdyvwhegtafhlfnlqdgheavcevpaadgsviftlkaartgntitvtgageaknwtl
    clrnvvkvnglqdgsqaeseqglvvkpqgnaltitl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1we5D (D:)
    mkisdgnwliqpglnlihplqvfeveqqdnemvvyaaprdvrertwqldtplftlrffsp
    qegivgvriehfqgalnngphyplnilqdvkvtienteryaefksgnlsarvskgefwsl
    dflrngeritgsqvknngyvqdtnnqrnymferldlgvgetvyglgerftalvrngqtve
    twnrdggtsteqayknipfymtnrgygvlvnhpqcvsfevgsekvskvqfsveseyleyf
    vidgptpkavldrytrftgrpalppawsfglwlttsfttnydeatvnsfidgmaernlpl
    hvfhfdcfwmkafqwcdfewdpltfpdpegmirrlkakglkicvwinpyigqkspvfkel
    qekgyllkrpdgslwqwdkwqpglaiydftnpdackwyadklkglvamgvdcfktdfger
    iptdvqwfdgsdpqkmhnhyayiynelvwnvlkdtvgeeeavlfarsasvgaqkfpvhwg
    gdcyanyesmaeslrgglsiglsgfgfwshdiggfentapahvykrwcafgllsshsrlh
    gsksyrvpwayddescdvvrfftqlkcrmmpylyreaaranargtpmmrammmefpddpa
    cdyldrqymlgdnvmvapvfteagdvqfylpegrwthlwhndeldgsrwhkqqhgflslp
    vyvrdntllalgnndqrpdyvwhegtafhlfnlqdgheavcevpaadgsviftlkaartg
    ntitvtgageaknwtlclrnvvkvnglqdgsqaeseqglvvkpqgnaltitl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1we5D (D:)
    mkisdgnwliqpglnlihplqvfeveqqdnemvvyaaprdvrertwqldtplftlrffsp
    qegivgvriehfqgalnngphyplnilqdvkvtienteryaefksgnlsarvskgefwsl
    dflrngeritgsqvknngyvqdtnnqrnymferldlgvgetvyglgerftalvrngqtve
    twnrdggtsteqayknipfymtnrgygvlvnhpqcvsfevgsekvskvqfsveseyleyf
    vidgptpkavldrytrftgrpalppawsfglwlttsfttnydeatvnsfidgmaernlpl
    hvfhfdcfwmkafqwcdfewdpltfpdpegmirrlkakglkicvwinpyigqkspvfkel
    qekgyllkrpdgslwqwdkwqpglaiydftnpdackwyadklkglvamgvdcfktdfger
    iptdvqwfdgsdpqkmhnhyayiynelvwnvlkdtvgeeeavlfarsasvgaqkfpvhwg
    gdcyanyesmaeslrgglsiglsgfgfwshdiapahvykrwcafgllsshsrlhgsddes
    cdvvrfftqlkcrmmpylyreaaranargtpmmrammmefpddpacdyldrqymlgdnvm
    vapvfteagdvqfylpegrwthlwhndeldgsrwhkqqhgflslpvyvrdntllalgnnd
    qrpdyvwhegtafhlfnlqdgheavcevpaadgsviftlkaartgntitvtgageaknwt
    lclrnvvkvnglqdgsqaeseqglvvkpqgnaltitl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1we5E (E:)
    mkisdgnwliqpglnlihplqvfeveqqdnemvvyaaprdvrertwqldtplftlrffsp
    qegivgvriehfqgalnngphyplnilqdvkvtienteryaefksgnlsarvskgefwsl
    dflrngeritgsqvknngyvqdtnnqrnymferldlgvgetvyglgerftalvrngqtve
    twnrdggtsteqayknipfymtnrgygvlvnhpqcvsfevgsekvskvqfsveseyleyf
    vidgptpkavldrytrftgrpalppawsfglwlttsfttnydeatvnsfidgmaernlpl
    hvfhfdcfwmkafqwcdfewdpltfpdpegmirrlkakglkicvwinpyigqkspvfkel
    qekgyllkrpdgslwqwdkwqpglaiydftnpdackwyadklkglvamgvdcfktdfger
    iptdvqwfdgsdpqkmhnhyayiynelvwnvlkdtvgeeeavlfarsasvgaqkfpvhwg
    gdcyanyesmaeslrgglsiglsgfgfwshdiggfentapahvykrwcafgllsshsrlh
    gsksyrvpwayddescdvvrfftqlkcrmmpylyreaaranargtpmmrammmefpddpa
    cdyldrqymlgdnvmvapvfteagdvqfylpegrwthlwhndeldgsrwhkqqhgflslp
    vyvrdntllalgnndqrpdyvwhegtafhlfnlqdgheavcevpaadgsviftlkaartg
    ntitvtgageaknwtlclrnvvkvnglqdgsqaeseqglvvkpqgnaltitl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1we5E (E:)
    mkisdgnwliqpglnlihplqvfeveqqdnemvvyaaprdvrertwqldtplftlrffsp
    qegivgvriehfqgalnngphyplnilqdvkvtienteryaefksgnlsarvskgefwsl
    dflrngeritgsqvknngyvqdtnnqrnymferldlgvgetvyglgerftalvrngqtve
    twnrdggtsteqayknipfymtnrgygvlvnhpqcvsfevgsekvskvqfsveseyleyf
    vidgptpkavldrytrftgrpalppawsfglwlttsfttnydeatvnsfidgmaernlpl
    hvfhfdcfwmkafqwcdfewdpltfpdpegmirrlkakglkicvwinpyigqkspvfkel
    qekgyllkrpdgslwqwdkwqpglaiydftnpdackwyadklkglvamgvdcfktdfger
    iptdvqwfdgsdpqkmhnhyayiynelvwnvlkdtvgeeeavlfarsasvgaqkfpvhwg
    gdcyanyesmaeslrgglsiglsgfgfwshdiapahvykrwcafgllsshsrlhddescd
    vvrfftqlkcrmmpylyreaaranargtpmmrammmefpddpacdyldrqymlgdnvmva
    pvfteagdvqfylpegrwthlwhndeldgsrwhkqqhgflslpvyvrdntllalgnndqr
    pdyvwhegtafhlfnlqdgheavcevpaadgsviftlkaartgntitvtgageaknwtlc
    lrnvvkvnglqdgsqaeseqglvvkpqgnaltitl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1we5F (F:)
    mkisdgnwliqpglnlihplqvfeveqqdnemvvyaaprdvrertwqldtplftlrffsp
    qegivgvriehfqgalnngphyplnilqdvkvtienteryaefksgnlsarvskgefwsl
    dflrngeritgsqvknngyvqdtnnqrnymferldlgvgetvyglgerftalvrngqtve
    twnrdggtsteqayknipfymtnrgygvlvnhpqcvsfevgsekvskvqfsveseyleyf
    vidgptpkavldrytrftgrpalppawsfglwlttsfttnydeatvnsfidgmaernlpl
    hvfhfdcfwmkafqwcdfewdpltfpdpegmirrlkakglkicvwinpyigqkspvfkel
    qekgyllkrpdgslwqwdkwqpglaiydftnpdackwyadklkglvamgvdcfktdfger
    iptdvqwfdgsdpqkmhnhyayiynelvwnvlkdtvgeeeavlfarsasvgaqkfpvhwg
    gdcyanyesmaeslrgglsiglsgfgfwshdiggfentapahvykrwcafgllsshsrlh
    gsksyrvpwayddescdvvrfftqlkcrmmpylyreaaranargtpmmrammmefpddpa
    cdyldrqymlgdnvmvapvfteagdvqfylpegrwthlwhndeldgsrwhkqqhgflslp
    vyvrdntllalgnndqrpdyvwhegtafhlfnlqdgheavcevpaadgsviftlkaartg
    ntitvtgageaknwtlclrnvvkvnglqdgsqaeseqglvvkpqgnaltitl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1we5F (F:)
    mkisdgnwliqpglnlihplqvfeveqqdnemvvyaaprdvrertwqldtplftlrffsp
    qegivgvriehfqgalnngphyplnilqdvkvtienteryaefksgnlsarvskgefwsl
    dflrngeritgsqvknngyvqdtnnqrnymferldlgvgetvyglgerftalvrngqtve
    twnrdggtsteqayknipfymtnrgygvlvnhpqcvsfevgsekvskvqfsveseyleyf
    vidgptpkavldrytrftgrpalppawsfglwlttsfttnydeatvnsfidgmaernlpl
    hvfhfdcfwmkafqwcdfewdpltfpdpegmirrlkakglkicvwinpyigqkspvfkel
    qekgyllkrpdgslwqwdkwqpglaiydftnpdackwyadklkglvamgvdcfktdfger
    iptdvqwfdgsdpqkmhnhyayiynelvwnvlkdtvgeeeavlfarsasvgaqkfpvhwg
    gdcyanyesmaeslrgglsiglsgfgfwshdigapahvykrwcafgllsshsrlhgddes
    cdvvrfftqlkcrmmpylyreaaranargtpmmrammmefpddpacdyldrqymlgdnvm
    vapvfteagdvqfylpegrwthlwhndeldgsrwhkqqhgflslpvyvrdntllalgnnd
    qrpdyvwhegtafhlfnlqdgheavcevpaadgsviftlkaartgntitvtgageaknwt
    lclrnvvkvnglqdgsqaeseqglvvkpqgnaltitl