PDB entry 1we3

View 1we3 on RCSB PDB site
Description: Crystal Structure of the Chaperonin Complex Cpn60/Cpn10/(ADP)7 from Thermus Thermophilus
Deposited on 2004-05-23, released 2004-06-29
The last revision prior to the SCOP 1.71 freeze date was dated 2004-09-14, with a file datestamp of 2004-09-14.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.239
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1we3A (A:)
    makilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakeve
    ledhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgie
    kaveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesks
    letelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaq
    tgkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvis
    eelgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyar
    eklqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllra
    isaveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfn
    aatgefvdmveagivdpakvtrsalqnaasigaliltteavvaekpekkestpasagagd
    mdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1we3A (A:)
    akilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakevel
    edhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgiek
    aveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesksl
    etelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaqt
    gkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvise
    elgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyare
    klqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllrai
    saveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfna
    atgefvdmveagivdpakvtrsalqnaasigaliltteavvaekpek
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1we3B (B:)
    makilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakeve
    ledhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgie
    kaveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesks
    letelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaq
    tgkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvis
    eelgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyar
    eklqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllra
    isaveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfn
    aatgefvdmveagivdpakvtrsalqnaasigaliltteavvaekpekkestpasagagd
    mdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1we3B (B:)
    akilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakevel
    edhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgiek
    aveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesksl
    etelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaqt
    gkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvise
    elgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyare
    klqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllrai
    saveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfna
    atgefvdmveagivdpakvtrsalqnaasigaliltteavvaekpek
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1we3C (C:)
    makilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakeve
    ledhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgie
    kaveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesks
    letelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaq
    tgkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvis
    eelgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyar
    eklqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllra
    isaveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfn
    aatgefvdmveagivdpakvtrsalqnaasigaliltteavvaekpekkestpasagagd
    mdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1we3C (C:)
    akilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakevel
    edhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgiek
    aveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesksl
    etelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaqt
    gkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvise
    elgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyare
    klqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllrai
    saveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfna
    atgefvdmveagivdpakvtrsalqnaasigaliltteavvaekpe
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1we3D (D:)
    makilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakeve
    ledhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgie
    kaveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesks
    letelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaq
    tgkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvis
    eelgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyar
    eklqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllra
    isaveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfn
    aatgefvdmveagivdpakvtrsalqnaasigaliltteavvaekpekkestpasagagd
    mdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1we3D (D:)
    akilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakevel
    edhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgiek
    aveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesksl
    etelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaqt
    gkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvise
    elgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyare
    klqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllrai
    saveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfna
    atgefvdmveagivdpakvtrsalqnaasigaliltteavvaekpe
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1we3E (E:)
    makilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakeve
    ledhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgie
    kaveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesks
    letelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaq
    tgkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvis
    eelgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyar
    eklqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllra
    isaveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfn
    aatgefvdmveagivdpakvtrsalqnaasigaliltteavvaekpekkestpasagagd
    mdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1we3E (E:)
    akilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakevel
    edhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgiek
    aveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesksl
    etelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaqt
    gkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvise
    elgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyare
    klqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllrai
    saveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfna
    atgefvdmveagivdpakvtrsalqnaasigaliltteavvaekpe
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1we3F (F:)
    makilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakeve
    ledhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgie
    kaveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesks
    letelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaq
    tgkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvis
    eelgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyar
    eklqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllra
    isaveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfn
    aatgefvdmveagivdpakvtrsalqnaasigaliltteavvaekpekkestpasagagd
    mdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1we3F (F:)
    akilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakevel
    edhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgiek
    aveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesksl
    etelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaqt
    gkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvise
    elgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyare
    klqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllrai
    saveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfna
    atgefvdmveagivdpakvtrsalqnaasigaliltteavvaekpekke
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1we3G (G:)
    makilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakeve
    ledhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgie
    kaveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesks
    letelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaq
    tgkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvis
    eelgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyar
    eklqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllra
    isaveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfn
    aatgefvdmveagivdpakvtrsalqnaasigaliltteavvaekpekkestpasagagd
    mdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1we3G (G:)
    akilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakevel
    edhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgiek
    aveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesksl
    etelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaqt
    gkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvise
    elgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyare
    klqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllrai
    saveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfna
    atgefvdmveagivdpakvtrsalqnaasigaliltteavvaekp
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1we3H (H:)
    makilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakeve
    ledhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgie
    kaveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesks
    letelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaq
    tgkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvis
    eelgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyar
    eklqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllra
    isaveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfn
    aatgefvdmveagivdpakvtrsalqnaasigaliltteavvaekpekkestpasagagd
    mdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1we3H (H:)
    akilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakevel
    edhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgiek
    aveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesksl
    etelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaqt
    gkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvise
    elgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyare
    klqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllrai
    saveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfna
    atgefvdmveagivdpakvtrsalqnaasigaliltteavvaekpe
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1we3I (I:)
    makilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakeve
    ledhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgie
    kaveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesks
    letelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaq
    tgkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvis
    eelgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyar
    eklqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllra
    isaveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfn
    aatgefvdmveagivdpakvtrsalqnaasigaliltteavvaekpekkestpasagagd
    mdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1we3I (I:)
    akilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakevel
    edhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgiek
    aveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesksl
    etelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaqt
    gkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvise
    elgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyare
    klqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllrai
    saveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfna
    atgefvdmveagivdpakvtrsalqnaasigaliltteavvaekp
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1we3J (J:)
    makilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakeve
    ledhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgie
    kaveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesks
    letelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaq
    tgkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvis
    eelgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyar
    eklqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllra
    isaveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfn
    aatgefvdmveagivdpakvtrsalqnaasigaliltteavvaekpekkestpasagagd
    mdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1we3J (J:)
    akilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakevel
    edhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgiek
    aveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesksl
    etelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaqt
    gkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvise
    elgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyare
    klqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllrai
    saveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfna
    atgefvdmveagivdpakvtrsalqnaasigaliltteavvaekp
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1we3K (K:)
    makilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakeve
    ledhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgie
    kaveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesks
    letelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaq
    tgkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvis
    eelgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyar
    eklqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllra
    isaveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfn
    aatgefvdmveagivdpakvtrsalqnaasigaliltteavvaekpekkestpasagagd
    mdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1we3K (K:)
    akilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakevel
    edhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgiek
    aveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesksl
    etelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaqt
    gkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvise
    elgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyare
    klqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllrai
    saveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfna
    atgefvdmveagivdpakvtrsalqnaasigaliltteavvaekp
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1we3L (L:)
    makilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakeve
    ledhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgie
    kaveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesks
    letelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaq
    tgkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvis
    eelgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyar
    eklqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllra
    isaveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfn
    aatgefvdmveagivdpakvtrsalqnaasigaliltteavvaekpekkestpasagagd
    mdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1we3L (L:)
    akilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakevel
    edhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgiek
    aveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesksl
    etelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaqt
    gkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvise
    elgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyare
    klqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllrai
    saveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfna
    atgefvdmveagivdpakvtrsalqnaasigaliltteavvaekpe
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1we3M (M:)
    makilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakeve
    ledhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgie
    kaveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesks
    letelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaq
    tgkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvis
    eelgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyar
    eklqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllra
    isaveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfn
    aatgefvdmveagivdpakvtrsalqnaasigaliltteavvaekpekkestpasagagd
    mdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1we3M (M:)
    akilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakevel
    edhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgiek
    aveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesksl
    etelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaqt
    gkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvise
    elgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyare
    klqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllrai
    saveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfna
    atgefvdmveagivdpakvtrsalqnaasigaliltteavvaekp
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >1we3N (N:)
    makilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakeve
    ledhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgie
    kaveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesks
    letelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaq
    tgkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvis
    eelgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyar
    eklqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllra
    isaveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfn
    aatgefvdmveagivdpakvtrsalqnaasigaliltteavvaekpekkestpasagagd
    mdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1we3N (N:)
    akilvfdeaarralergvnavanavkvtlgprgrnvvlekkfgsptitkdgvtvakevel
    edhlenigaqllkevasktndvagdgtttatvlaqaivreglknvaaganplalkrgiek
    aveaavekikalaipvedrkaieevatisandpevgkliadamekvgkegiitveesksl
    etelkfvegyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaqt
    gkplliiaedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtvise
    elgfklenatlsmlgraervritkdettivggkgkkediearingikkelettdseyare
    klqerlaklaggvavirvgaatetelkekkhrfedalnatraaveegivpgggvtllrai
    saveelikklegdeatgakivrraleeparqiaenagyegsvivqqilaetknprygfna
    atgefvdmveagivdpakvtrsalqnaasigaliltteavvaekpe
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >1we3O (O:)
    aaevktvikplgdrvvvkrieeepktkggivlpdtakekpqkgkviavgtgrvlengqrv
    plevkegdivvfakyggteieidgeeyvilserdllavlq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1we3O (O:)
    ktvikplgdrvvvkrieeepktkggivlpdtakekpqkgkviavgtgrvlengqrvplev
    kegdivvfakyggteieidgeeyvilserdllavlq
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >1we3P (P:)
    aaevktvikplgdrvvvkrieeepktkggivlpdtakekpqkgkviavgtgrvlengqrv
    plevkegdivvfakyggteieidgeeyvilserdllavlq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1we3P (P:)
    vikplgdrvvvkrieeepktkggivlpdtakekpqkgkviavgtgrvlengqrvplevke
    gdivvfakyggteieidgeeyvilserdllavlq
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >1we3Q (Q:)
    aaevktvikplgdrvvvkrieeepktkggivlpdtakekpqkgkviavgtgrvlengqrv
    plevkegdivvfakyggteieidgeeyvilserdllavlq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1we3Q (Q:)
    ktvikplgdrvvvkrieeepktkggivlpdtakekpqkgkviavgtgrvlengqrvplev
    kegdivvfakyggteieidgeeyvilserdllavlq
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >1we3R (R:)
    aaevktvikplgdrvvvkrieeepktkggivlpdtakekpqkgkviavgtgrvlengqrv
    plevkegdivvfakyggteieidgeeyvilserdllavlq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1we3R (R:)
    ktvikplgdrvvvkrieeepktkggivlpdtakekpqkgkviavgtgrvlengqrvplev
    kegdivvfakyggteieidgeeyvilserdllavlq
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >1we3S (S:)
    aaevktvikplgdrvvvkrieeepktkggivlpdtakekpqkgkviavgtgrvlengqrv
    plevkegdivvfakyggteieidgeeyvilserdllavlq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1we3S (S:)
    ktvikplgdrvvvkrieeepktkggivlpdtakekpqkgkviavgtgrvlengqrvplev
    kegdivvfakyggteieidgeeyvilserdllavlq
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >1we3T (T:)
    aaevktvikplgdrvvvkrieeepktkggivlpdtakekpqkgkviavgtgrvlengqrv
    plevkegdivvfakyggteieidgeeyvilserdllavlq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1we3T (T:)
    ktvikplgdrvvvkrieeepktkggivlpdtakekpqkgkviavgtgrvlengqrvplev
    kegdivvfakyggteieidgeeyvilserdllavlq
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >1we3U (U:)
    aaevktvikplgdrvvvkrieeepktkggivlpdtakekpqkgkviavgtgrvlengqrv
    plevkegdivvfakyggteieidgeeyvilserdllavlq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1we3U (U:)
    ktvikplgdrvvvkrieeepktkggivlpdtakekpqkgkviavgtgrvlengqrvplev
    kegdivvfakyggteieidgeeyvilserdllavlq