PDB entry 1we1

View 1we1 on RCSB PDB site
Description: Crystal structure of heme oxygenase-1 from cyanobacterium Synechocystis sp. PCC6803 in complex with heme
Class: Oxidoreductase
Keywords: oxidoreductase
Deposited on 2004-05-21, released 2004-12-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.22
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heme oxygenase 1
    Species: Synechocystis sp. [TaxId:1148]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1we1a_
  • Chain 'B':
    Compound: Heme oxygenase 1
    Species: Synechocystis sp. [TaxId:1148]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1we1b_
  • Chain 'C':
    Compound: Heme oxygenase 1
    Species: Synechocystis sp. [TaxId:1148]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1we1c_
  • Chain 'D':
    Compound: Heme oxygenase 1
    Species: Synechocystis sp. [TaxId:1148]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1we1d_
  • Heterogens: PO4, CL, HEM, IPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1we1A (A:)
    msvnlasqlregtkkshsmaenvgfvkcflkgvveknsyrklvgnlyfvysameeemakf
    kdhpilshiyfpelnrkqsleqdlqfyygsnwrqevkisaagqayvdrvrqvaatapell
    vahsytrylgdlsggqilkkiaqnamnlhdggtafyefadiddekafkntyrqamndlpi
    dqataerivdeandafamnmkmfnelegnlikaigimvfnsltrrrsqgstevglatseg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1we1A (A:)
    svnlasqlregtkkshsmaenvgfvkcflkgvveknsyrklvgnlyfvysameeemakfk
    dhpilshiyfpelnrkqsleqdlqfyygsnwrqevkisaagqayvdrvrqvaatapellv
    ahsytrylgdlsggqilkkiaqnamnlhdggtafyefadiddekafkntyrqamndlpid
    qataerivdeandafamnmkmfnelegnlikaigimvfnslt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1we1B (B:)
    msvnlasqlregtkkshsmaenvgfvkcflkgvveknsyrklvgnlyfvysameeemakf
    kdhpilshiyfpelnrkqsleqdlqfyygsnwrqevkisaagqayvdrvrqvaatapell
    vahsytrylgdlsggqilkkiaqnamnlhdggtafyefadiddekafkntyrqamndlpi
    dqataerivdeandafamnmkmfnelegnlikaigimvfnsltrrrsqgstevglatseg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1we1B (B:)
    svnlasqlregtkkshsmaenvgfvkcflkgvveknsyrklvgnlyfvysameeemakfk
    dhpilshiyfpelnrkqsleqdlqfyygsnwrqevkisaagqayvdrvrqvaatapellv
    ahsytrylgdlsggqilkkiaqnamnlhdggtafyefadiddekafkntyrqamndlpid
    qataerivdeandafamnmkmfnelegnlikaigimvfnslt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1we1C (C:)
    msvnlasqlregtkkshsmaenvgfvkcflkgvveknsyrklvgnlyfvysameeemakf
    kdhpilshiyfpelnrkqsleqdlqfyygsnwrqevkisaagqayvdrvrqvaatapell
    vahsytrylgdlsggqilkkiaqnamnlhdggtafyefadiddekafkntyrqamndlpi
    dqataerivdeandafamnmkmfnelegnlikaigimvfnsltrrrsqgstevglatseg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1we1C (C:)
    svnlasqlregtkkshsmaenvgfvkcflkgvveknsyrklvgnlyfvysameeemakfk
    dhpilshiyfpelnrkqsleqdlqfyygsnwrqevkisaagqayvdrvrqvaatapellv
    ahsytrylgdlsggqilkkiaqnamnlhdggtafyefadiddekafkntyrqamndlpid
    qataerivdeandafamnmkmfnelegnlikaigimvfnslt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1we1D (D:)
    msvnlasqlregtkkshsmaenvgfvkcflkgvveknsyrklvgnlyfvysameeemakf
    kdhpilshiyfpelnrkqsleqdlqfyygsnwrqevkisaagqayvdrvrqvaatapell
    vahsytrylgdlsggqilkkiaqnamnlhdggtafyefadiddekafkntyrqamndlpi
    dqataerivdeandafamnmkmfnelegnlikaigimvfnsltrrrsqgstevglatseg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1we1D (D:)
    vnlasqlregtkkshsmaenvgfvkcflkgvveknsyrklvgnlyfvysameeemakfkd
    hpilshiyfpelnrkqsleqdlqfyygsnwrqevkisaagqayvdrvrqvaatapellva
    hsytrylgdlsggqilkkiaqnamnlhdggtafyefadiddekafkntyrqamndlpidq
    ataerivdeandafamnmkmfnelegnlikaigimvfnslt