PDB entry 1wdz

View 1wdz on RCSB PDB site
Description: Crystal structure of RCB domain of IRSp53
Class: signaling protein
Keywords: cellular signaling protein, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics
Deposited on 2004-05-21, released 2005-06-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.63 Å
R-factor: 0.235
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: insulin receptor substrate p53
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UQB8 (Start-230)
      • cloning artifact (231-234)
    Domains in SCOPe 2.07: d1wdza1, d1wdza2
  • Chain 'B':
    Compound: insulin receptor substrate p53
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UQB8 (Start-230)
      • cloning artifact (231-234)
    Domains in SCOPe 2.07: d1wdzb2, d1wdzb3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wdzA (A:)
    gstmslsrseemhrltenvyktimeqfnpslrnfiamgknyekalagvtyaakgyfdalv
    kmgelasesqgskelgdvlfqmaevhrqiqnqleemlksfhnelltqleqkveldsryls
    aalkkyqteqrskgdaldkcqaelkklrkksqgsknpqkysdkelqyidaisnkqgelen
    yvsdgyktalteerrrfcflvekqcavaknsaayhskgkellaqklplwqqgvdssgriv
    td
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wdzA (A:)
    slsrseemhrltenvyktimeqfnpslrnfiamgknyekalagvtyaakgyfdalvkmge
    lasesqgskelgdvlfqmaevhrqiqnqleemlksfhnelltqleqkveldsrylsaalk
    kyqteqrskgdaldkcqaelkklrkksqgsknpqkysdkelqyidaisnkqgelenyvsd
    gyktalteerrrfcflvekqcavaknsaayhskgkellaqklplwqqgvds
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wdzB (B:)
    gstmslsrseemhrltenvyktimeqfnpslrnfiamgknyekalagvtyaakgyfdalv
    kmgelasesqgskelgdvlfqmaevhrqiqnqleemlksfhnelltqleqkveldsryls
    aalkkyqteqrskgdaldkcqaelkklrkksqgsknpqkysdkelqyidaisnkqgelen
    yvsdgyktalteerrrfcflvekqcavaknsaayhskgkellaqklplwqqgvdssgriv
    td
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wdzB (B:)
    slsrseemhrltenvyktimeqfnpslrnfiamgknyekalagvtyaakgyfdalvkmge
    lasesqgskelgdvlfqmaevhrqiqnqleemlksfhnelltqleqkveldsrylsaalk
    kyqteqrskgdaldkcqaelkklrkksqdkelqyidaisnkqgelenyvsdgyktaltee
    rrrfcflvekqcavaknsaayhskgkellaqklplwqqgvds