PDB entry 1wdx

View 1wdx on RCSB PDB site
Description: Yeast BBC1 SH3 domain, triclinic crystal form
Deposited on 2004-05-19, released 2005-05-31
The last revision was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.266
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myosin tail region-interacting protein MTI1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Myosin tail region-interacting protein MTI1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Myosin tail region-interacting protein MTI1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Myosin tail region-interacting protein MTI1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1wdxA (A:)
    gmsepevpfkvvaqfpyksdyeddlnfekdqeiivtsvedaewyfgeyqdsngdviegif
    pksfvavqg
    

    Sequence, based on observed residues (ATOM records):
    >1wdxA (A:)
    pevpfkvvaqfpyksdyeddlnfekdqeiivtsvedaewyfgeyqdsngdviegifpksf
    vav
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1wdxB (B:)
    gmsepevpfkvvaqfpyksdyeddlnfekdqeiivtsvedaewyfgeyqdsngdviegif
    pksfvavqg
    

    Sequence, based on observed residues (ATOM records):
    >1wdxB (B:)
    pevpfkvvaqfpyksdyeddlnfekdqeiivtsvedaewyfgeyqdsngdviegifpksf
    vav
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >1wdxC (C:)
    gmsepevpfkvvaqfpyksdyeddlnfekdqeiivtsvedaewyfgeyqdsngdviegif
    pksfvavqg
    

    Sequence, based on observed residues (ATOM records):
    >1wdxC (C:)
    pevpfkvvaqfpyksdyeddlnfekdqeiivtsvedaewyfgeyqdsngdviegifpksf
    vav
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >1wdxD (D:)
    gmsepevpfkvvaqfpyksdyeddlnfekdqeiivtsvedaewyfgeyqdsngdviegif
    pksfvavqg
    

    Sequence, based on observed residues (ATOM records):
    >1wdxD (D:)
    pevpfkvvaqfpyksdyeddlnfekdqeiivtsvedaewyfgeyqdsngdviegifpksf
    vav