PDB entry 1wdv

View 1wdv on RCSB PDB site
Description: Crystal structure of hypothetical protein APE2540
Deposited on 2004-05-18, released 2004-11-18
The last revision prior to the SCOP 1.71 freeze date was dated 2004-11-18, with a file datestamp of 2004-11-18.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.169
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1wdva_
  • Chain 'B':
    Domains in SCOP 1.71: d1wdvb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wdvA (A:)
    mlekveewikargltwrllimqkptrtvaeaaallgvseseivktlivldnaggvyavvi
    pgdkrlninsmkelagkpvrlaranevveltgypvggvppvalppnivlvvdrillsrkk
    vyggggrenallefsprelveatgavvadvse
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wdvA (A:)
    ekveewikargltwrllimqkptrtvaeaaallgvseseivktlivldnaggvyavvipg
    dkrlninsmkelagkpvrlaranevveltgypvggvppvalppnivlvvdrillsrkkvy
    ggggrenallefsprelveatgavvadvse
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wdvB (B:)
    mlekveewikargltwrllimqkptrtvaeaaallgvseseivktlivldnaggvyavvi
    pgdkrlninsmkelagkpvrlaranevveltgypvggvppvalppnivlvvdrillsrkk
    vyggggrenallefsprelveatgavvadvse
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wdvB (B:)
    ekveewikargltwrllimqkptrtvaeaaallgvseseivktlivldnaggvyavvipg
    dkrlninsmkelagkpvrlaranevveltgypvggvppvalppnivlvvdrillsrkkvy
    ggggrenallefsprelveatgavvadvse