PDB entry 1wdv

View 1wdv on RCSB PDB site
Description: Crystal structure of hypothetical protein APE2540
Class: structural genomics, unknown function
Keywords: Structural genomics, unknown function, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2004-05-18, released 2004-11-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.169
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein APE2540
    Species: Aeropyrum pernix [TaxId:272557]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y8U3 (Start-151)
      • modified residue (20)
      • modified residue (70)
    Domains in SCOPe 2.07: d1wdva_
  • Chain 'B':
    Compound: hypothetical protein APE2540
    Species: Aeropyrum pernix [TaxId:272557]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y8U3 (Start-151)
      • modified residue (20)
      • modified residue (70)
    Domains in SCOPe 2.07: d1wdvb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wdvA (A:)
    mlekveewikargltwrllimqkptrtvaeaaallgvseseivktlivldnaggvyavvi
    pgdkrlninsmkelagkpvrlaranevveltgypvggvppvalppnivlvvdrillsrkk
    vyggggrenallefsprelveatgavvadvse
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wdvA (A:)
    ekveewikargltwrllimqkptrtvaeaaallgvseseivktlivldnaggvyavvipg
    dkrlninsmkelagkpvrlaranevveltgypvggvppvalppnivlvvdrillsrkkvy
    ggggrenallefsprelveatgavvadvse
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wdvB (B:)
    mlekveewikargltwrllimqkptrtvaeaaallgvseseivktlivldnaggvyavvi
    pgdkrlninsmkelagkpvrlaranevveltgypvggvppvalppnivlvvdrillsrkk
    vyggggrenallefsprelveatgavvadvse
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wdvB (B:)
    ekveewikargltwrllimqkptrtvaeaaallgvseseivktlivldnaggvyavvipg
    dkrlninsmkelagkpvrlaranevveltgypvggvppvalppnivlvvdrillsrkkvy
    ggggrenallefsprelveatgavvadvse