PDB entry 1wdu

View 1wdu on RCSB PDB site
Description: Endonuclease domain of TRAS1, a telomere-specific non-LTR retrotransposon
Deposited on 2004-05-17, released 2004-08-10
The last revision prior to the SCOP 1.69 freeze date was dated 2004-08-10, with a file datestamp of 2004-08-10.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.225
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1wdua_
  • Chain 'B':
    Domains in SCOP 1.69: d1wdub_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wduA (A:)
    mhgeqwnttakvrpkngppyrvlqanlqrkklataelaieaatrkaaialiqepyvggak
    smkgfrgvrvfqstaqgdgtvkaaiavfdhdldviqypqlttnnivvvgirtraweitlv
    syyfepdkpiesyleqikrverkmgpkrlifggdanakstwwgskeddargdqlmgtlge
    lglhilnegdvptfdtirggkryqsrvdvtfctedmldlidgwrvdedlvssdhngmvfn
    irlqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wduA (A:)
    ppyrvlqanlqrkklataelaieaatrkaaialiqepyvkgfrgvrvfqstaqgdgtvka
    aiavfdhdldviqypqlttnnivvvgirtraweitlvsyyfepdkpiesyleqikrverk
    mgpkrlifggdanakstwwgskeddargdqlmgtlgelglhilnegdvptfdtryqsrvd
    vtfctedmldlidgwrvdedlvssdhngmvfnirlqk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wduB (B:)
    mhgeqwnttakvrpkngppyrvlqanlqrkklataelaieaatrkaaialiqepyvggak
    smkgfrgvrvfqstaqgdgtvkaaiavfdhdldviqypqlttnnivvvgirtraweitlv
    syyfepdkpiesyleqikrverkmgpkrlifggdanakstwwgskeddargdqlmgtlge
    lglhilnegdvptfdtirggkryqsrvdvtfctedmldlidgwrvdedlvssdhngmvfn
    irlqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wduB (B:)
    pyrvlqanlqrkklataelaieaatrkaaialiqepyvfrgvrvfqstaqgdgtvkaaia
    vfdhdldviqypqlttnnivvvgirtraweitlvsyyfepdkpiesyleqikrverkmgp
    krlifggdanakstwwgskeddargdqlmgtlgelglhilnegdvptfdtirggkryqsr
    vdvtfctedmldlidgwrvdedlvssdhngmvfnirlqk