PDB entry 1wdu

View 1wdu on RCSB PDB site
Description: Endonuclease domain of TRAS1, a telomere-specific non-LTR retrotransposon
Class: RNA binding protein
Keywords: four-layered alpha/beta sandwich, RNA BINDING PROTEIN
Deposited on 2004-05-17, released 2004-08-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.225
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: TRAS1 ORF2p
    Species: Bombyx mori [TaxId:7091]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q93139 (Start-244)
      • engineered (163)
    Domains in SCOPe 2.07: d1wdua_
  • Chain 'B':
    Compound: TRAS1 ORF2p
    Species: Bombyx mori [TaxId:7091]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q93139 (Start-244)
      • engineered (163)
    Domains in SCOPe 2.07: d1wdub_
  • Heterogens: PO4, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wduA (A:)
    mhgeqwnttakvrpkngppyrvlqanlqrkklataelaieaatrkaaialiqepyvggak
    smkgfrgvrvfqstaqgdgtvkaaiavfdhdldviqypqlttnnivvvgirtraweitlv
    syyfepdkpiesyleqikrverkmgpkrlifggdanakstwwgskeddargdqlmgtlge
    lglhilnegdvptfdtirggkryqsrvdvtfctedmldlidgwrvdedlvssdhngmvfn
    irlqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wduA (A:)
    ppyrvlqanlqrkklataelaieaatrkaaialiqepyvkgfrgvrvfqstaqgdgtvka
    aiavfdhdldviqypqlttnnivvvgirtraweitlvsyyfepdkpiesyleqikrverk
    mgpkrlifggdanakstwwgskeddargdqlmgtlgelglhilnegdvptfdtryqsrvd
    vtfctedmldlidgwrvdedlvssdhngmvfnirlqk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wduB (B:)
    mhgeqwnttakvrpkngppyrvlqanlqrkklataelaieaatrkaaialiqepyvggak
    smkgfrgvrvfqstaqgdgtvkaaiavfdhdldviqypqlttnnivvvgirtraweitlv
    syyfepdkpiesyleqikrverkmgpkrlifggdanakstwwgskeddargdqlmgtlge
    lglhilnegdvptfdtirggkryqsrvdvtfctedmldlidgwrvdedlvssdhngmvfn
    irlqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wduB (B:)
    pyrvlqanlqrkklataelaieaatrkaaialiqepyvfrgvrvfqstaqgdgtvkaaia
    vfdhdldviqypqlttnnivvvgirtraweitlvsyyfepdkpiesyleqikrverkmgp
    krlifggdanakstwwgskeddargdqlmgtlgelglhilnegdvptfdtirggkryqsr
    vdvtfctedmldlidgwrvdedlvssdhngmvfnirlqk