PDB entry 1wdt

View 1wdt on RCSB PDB site
Description: Crystal structure of ttk003000868 from Thermus thermophilus HB8
Class: structural genomics, unknown function
Keywords: GTP Complex, STRUCTURAL GENOMICS, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2004-05-17, released 2005-05-17
The last revision prior to the SCOP 1.75 freeze date was dated 2005-05-17, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.197
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: elongation factor G homolog
    Species: Thermus thermophilus
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SI76 (7-664)
      • cloning artifact (5-6)
    Domains in SCOP 1.75: d1wdta1, d1wdta2, d1wdta3, d1wdta4, d1wdta5
  • Heterogens: MG, GTP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wdtA (A:)
    mgteggamirtvalvghagsgkttlteallyktgakerrgrveegttttdytpeaklhrt
    tvrtgvapllfrghrvflldapgygdfvgeirgaleaadaalvavsaeagvqvgterawt
    vaerlglprmvvvtkldkggdyyalledlrstlgpilpidlplyeggkwvglidvfhgka
    yryengeereaevppeerervqrfrqevleaivetdegllekylegeevtgealekafhe
    avrrgllypvalasgereigvlpllelilealpspterfgdgpplakvfkvqvdpfmgqv
    aylrlyrgrlkpgdslqseagqvrlphlyvpmgkdlleveeaeagfvlgvpkaeglhrgm
    vlwqgekpeseevpfarlpdpnvpvalhpkgrtdearlgealrklleedpslklerqeet
    gelllwghgelhlatakerlqdygvevefsvpkvpyretikkvaegqgkykkqtgghgqy
    gdvwlrlepaseygfewritggvipskyqeaieegikeaakkgvlagfpvmgfkaivyng
    syhevdssdlafqiaaslafkkvmaeahpvllepiyrlkvlapqervgdvlsdlqarrgr
    ilgmeqegalsvvhaevplaevleyykalpgltggagaytlefshyaevpphlaqrivqe
    raqeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wdtA (A:)
    gamirtvalvghagsgkttlteallyktgakerrgrveegttttdytpeaklhrttvrtg
    vapllfrghrvflldapgygdfvgeirgaleaadaalvavsaeagvqvgterawtvaerl
    glprmvvvtkldkggdyyalledlrstlgpilpidlplyeggkwvglidvfhgkayryen
    geereaevppeerervqrfrqevleaivetdegllekylegeevtgealekafheavrrg
    llypvalasgereigvlpllelilealpspterfgdgpplakvfkvqvdpfmgqvaylrl
    yrgrlkpgdslqseagqvrlphlyvpmgkdlleveeaeagfvlgvpkaeglhrgmvlwqg
    ekpeseevpfarlpdpnvpvalhpkgrtdearlgealrklleedpslklerqeetgelll
    wghgelhlatakerlqdygvevefsvpkvpyretikkvaegqgkykkqtgghgqygdvwl
    rlepaseygfewritggvipskyqeaieegikeaakkgvlagfpvmgfkaivyngsyhev
    dssdlafqiaaslafkkvmaeahpvllepiyrlkvlapqervgdvlsdlqarrgrilgme
    qegalsvvhaevplaevleyykalpgltggagaytlefshyaevpphlaqrivqeraqeg