PDB entry 1wdr

View 1wdr on RCSB PDB site
Description: The role of an inner loop in the catalytic mechanism of soybean beta-amylase
Class: Hydrolase
Keywords: (beta/alpha)8 barrel, Hydrolase
Deposited on 2004-05-17, released 2005-04-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.131
AEROSPACI score: 0.76 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-amylase
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10538 (Start-494)
      • see remark 999 (75)
      • see remark 999 (201)
      • engineered (341)
      • see remark 999 (398)
    Domains in SCOPe 2.07: d1wdra1
  • Heterogens: MAL, GLC, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wdrA (A:)
    atsdsnmllnyvpvyvmlplgvvnvdnvfedpdglkeqllqlraagvdgvmvdvwwgiie
    lkgpkqydwrayrsllqlvqecgltlqaimsfhqcggnvgdivnipipqwvldigesnhd
    ifytnrsgtrnkeyltvgvdnepifhgrtaieiysdymksfrenmsdflesgliidievg
    lgpagelrypsypqsqgwefpgigefqcydkylkadfkaavaraghpewelpddagkynd
    vpestgffksngtyvtekgkffltwysnkllnhgdqildeankaflgckvklaikvsgih
    wwykvenhaaeltagyynlndrdgyrpiarmlsrhhailnfsclemrdseqpsdaksgpq
    elvqqvlsggwredirvagenalprydataynqiilnarpqgvnnngppklsmfgvtylr
    lsddllqksnfnifkkfvlkmhadqdycanpqkynhaitplkpsapkipievlleatkpt
    lpfpwlpetdmkvdg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wdrA (A:)
    sdsnmllnyvpvyvmlplgvvnvdnvfedpdglkeqllqlraagvdgvmvdvwwgiielk
    gpkqydwrayrsllqlvqecgltlqaimsfhqcggnvgdivnipipqwvldigesnhdif
    ytnrsgtrnkeyltvgvdnepifhgrtaieiysdymksfrenmsdflesgliidievglg
    pagelrypsypqsqgwefpgigefqcydkylkadfkaavaraghpewelpddagkyndvp
    estgffksngtyvtekgkffltwysnkllnhgdqildeankaflgckvklaikvsgihww
    ykvenhaaeltagyynlndrdgyrpiarmlsrhhailnfsclemrdseqpsdaksgpqel
    vqqvlsggwredirvagenalprydataynqiilnarpqgvnnngppklsmfgvtylrls
    ddllqksnfnifkkfvlkmhadqdycanpqkynhaitplkpsapkipievlleatkptlp
    fpwlpetdmkvdg