PDB entry 1wdn

View 1wdn on RCSB PDB site
Description: glutamine-binding protein
Class: complex (binding protein/peptide)
Keywords: binding protein, glnbp, closed form, complex, peptide, complex (binding protein/peptide)
Deposited on 1997-05-17, released 1998-05-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: 0.2
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutamine binding protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10344 (Start-225)
      • conflict (22)
    Domains in SCOPe 2.07: d1wdna_
  • Heterogens: GLN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wdnA (A:)
    adkklvvatdtafvpfefkqgdlyvgfdvdlwaaiakelkldyelkpmdfsgiipalqtk
    nvdlalagititderkkaidfsdgyyksgllvmvkannndvksvkdldgkvvavksgtgs
    vdyakaniktkdlrqfpnidnaymelgtnradavlhdtpnilyfiktagngqfkavgdsl
    eaqqygiafpkgsdelrdkvngalktlrengtyneiykkwfgtepk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wdnA (A:)
    klvvatdtafvpfefkqgdlyvgfdvdlwaaiakelkldyelkpmdfsgiipalqtknvd
    lalagititderkkaidfsdgyyksgllvmvkannndvksvkdldgkvvavksgtgsvdy
    akaniktkdlrqfpnidnaymelgtnradavlhdtpnilyfiktagngqfkavgdsleaq
    qygiafpkgsdelrdkvngalktlrengtyneiykkwfgtepk