PDB entry 1wdl

View 1wdl on RCSB PDB site
Description: fatty acid beta-oxidation multienzyme complex from Pseudomonas fragi, form II (native4)
Class: lyase,oxidoreductase/transferase
Keywords: alpha2beta2 heterotetrameric complex, LYASE,OXIDOREDUCTASE/TRANSFERASE COMPLEX
Deposited on 2004-05-17, released 2004-07-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: 0.233
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fatty oxidation complex alpha subunit
    Species: Pseudomonas fragi [TaxId:296]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wdla1, d1wdla2, d1wdla3, d1wdla4
  • Chain 'B':
    Compound: Fatty oxidation complex alpha subunit
    Species: Pseudomonas fragi [TaxId:296]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wdlb1, d1wdlb2, d1wdlb3, d1wdlb4
  • Chain 'C':
    Compound: 3-ketoacyl-CoA thiolase
    Species: Pseudomonas fragi [TaxId:296]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wdlc1, d1wdlc2
  • Chain 'D':
    Compound: 3-ketoacyl-CoA thiolase
    Species: Pseudomonas fragi [TaxId:296]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wdld1, d1wdld2
  • Heterogens: ACO, NAD, N8E

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wdlA (A:)
    miyegkaitvtalesgivelkfdlkgesvnkfnrltlnelrqavdaikadasvkgvivss
    gkdvfivgaditefvenfklpdaeliagnleankifsdfedlnvptvaaingialgggle
    mclaadfrvmadsakiglpevklgiypgfggtvrlprligvdnavewiasgkenraedal
    kvsavdavvtadklgaaaldlikraisgeldykakrqpkleklklnaieqmmafetakgf
    vagqagpnypapveaiktiqkaanfgrdkaleveaagfaklaktsasncliglflndqel
    kkkakvydkiakdvkqaavlgagimgggiayqsaskgtpilmkdinehgieqglaeaakl
    lvgrvdkgrmtpakmaevlngirptlsygdfgnvdlvveavvenpkvkqavlaevenhvr
    edailasntstisisllakalkrpenfvgmhffnpvhmmplvevirgekssdlavattva
    yakkmgknpivvndcpgflvnrvlfpyfggfaklvsagvdfvridkvmekfgwpmgpayl
    mdvvgidtghhgrdvmaegfpdrmkddrrsaidalyeakrlgqkngkgfyayeadkkgkq
    kklvdssvlevlkpivyeqrdvtdediinwmmiplcletvrcledgivetaaeadmglvy
    gigfplfrggalryidsigvaefvaladqyaelgalyhptaklremakngqsffg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wdlB (B:)
    miyegkaitvtalesgivelkfdlkgesvnkfnrltlnelrqavdaikadasvkgvivss
    gkdvfivgaditefvenfklpdaeliagnleankifsdfedlnvptvaaingialgggle
    mclaadfrvmadsakiglpevklgiypgfggtvrlprligvdnavewiasgkenraedal
    kvsavdavvtadklgaaaldlikraisgeldykakrqpkleklklnaieqmmafetakgf
    vagqagpnypapveaiktiqkaanfgrdkaleveaagfaklaktsasncliglflndqel
    kkkakvydkiakdvkqaavlgagimgggiayqsaskgtpilmkdinehgieqglaeaakl
    lvgrvdkgrmtpakmaevlngirptlsygdfgnvdlvveavvenpkvkqavlaevenhvr
    edailasntstisisllakalkrpenfvgmhffnpvhmmplvevirgekssdlavattva
    yakkmgknpivvndcpgflvnrvlfpyfggfaklvsagvdfvridkvmekfgwpmgpayl
    mdvvgidtghhgrdvmaegfpdrmkddrrsaidalyeakrlgqkngkgfyayeadkkgkq
    kklvdssvlevlkpivyeqrdvtdediinwmmiplcletvrcledgivetaaeadmglvy
    gigfplfrggalryidsigvaefvaladqyaelgalyhptaklremakngqsffg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wdlB (B:)
    miyegkaitvtalesgivelkfdlkgesvnkfnrltlnelrqavdaikadasvkgvivss
    gkdvfivgaditefvenfklpdaeliagnleankifsdfedlnvptvaaingialgggle
    mclaadfrvmadsakiglpevklgiypgfggtvrlprligvdnavewiasgkenraedal
    kvsavdavvtadklgaaaldlikraisgeldykakrqpkleklklnaieqmmafetakgf
    vagqagpnypapveaiktiqkaanfgrdkaleveaagfaklaktsasncliglflndqel
    kkkakvydkiakdvkqaavlgagimgggiayqsaskgtpilmkdinehgieqglaeaakl
    lvgrvdkgrmtpakmaevlngirptlsygdfgnvdlvveavvenpkvkqavlaevenhvr
    edailasntstisisllakalkrpenfvgmhffnpvhmmplvevirgekssdlavattva
    yakkmgknpivvndcpgflvnrvlfpyfggfaklvsagvdfvridkvmekfgwpmgpayl
    mdvvgidtghhgrdvmaegfpdrmkddrrsaidalyeakrlgqkngkgfyayklvdssvl
    evlkpivyeqrdvtdediinwmmiplcletvrcledgivetaaeadmglvygigfplfrg
    galryidsigvaefvaladqyaelgalyhptaklremakngqsffg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wdlC (C:)
    slnprdvvivdfgrtpmgrskggmhrntraedmsahliskvlernskvdpgevedviwgc
    vnqtleqgwniarmaslmtqiphtsaaqtvsrlcgssmsalhtaaqaimtgngdvfvvgg
    vehmghvsmmhgvdpnphmslyaakasgmmgltaemlgkmhgisreqqdafavrshqlah
    katvegkfkdeiipmqgydengflkifdydetirpdttleslaalkpafnpkggtvtagt
    ssqitdgascmivmsaqrakdlgleplavirsmavagvdpaimgygpvpatqkalkragl
    nmadidfielneafaaqalpvlkdlkvldkmnekvnlhggaialghpfgcsgarisgtll
    nvmkqnggtfglstmciglgqgiatvferv
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wdlD (D:)
    slnprdvvivdfgrtpmgrskggmhrntraedmsahliskvlernskvdpgevedviwgc
    vnqtleqgwniarmaslmtqiphtsaaqtvsrlcgssmsalhtaaqaimtgngdvfvvgg
    vehmghvsmmhgvdpnphmslyaakasgmmgltaemlgkmhgisreqqdafavrshqlah
    katvegkfkdeiipmqgydengflkifdydetirpdttleslaalkpafnpkggtvtagt
    ssqitdgascmivmsaqrakdlgleplavirsmavagvdpaimgygpvpatqkalkragl
    nmadidfielneafaaqalpvlkdlkvldkmnekvnlhggaialghpfgcsgarisgtll
    nvmkqnggtfglstmciglgqgiatvferv