PDB entry 1wdj

View 1wdj on RCSB PDB site
Description: Crystal structure of TT1808 from Thermus thermophilus HB8
Class: Structural genomics, unknown function
Keywords: Structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, unknown function
Deposited on 2004-05-17, released 2004-11-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.189
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein TT1808
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wdja_
  • Chain 'B':
    Compound: hypothetical protein TT1808
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wdjb_
  • Chain 'C':
    Compound: hypothetical protein TT1808
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wdjc_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wdjA (A:)
    mplvldlarpvseeelrrlselnpgyqwerspegrlwvsptggesgrrslqlayqlarwn
    eerglgvvfdsstgfkfpdgsilspdaafvergawealseaeregfpplapkavfevrsa
    sqdpeelrakmgiylrngvllgvlvdpyaravevfrpgkpplrlegvervsldpelpgfa
    lslpplw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wdjA (A:)
    plvldlarpvseeelrrlselnpgyqwerspegrlwvsptggesgrrslqlayqlarwne
    erglgvvfdsstgfkfpdgsilspdaafvergawealseaeregfpplapkavfevrsas
    qdpeelrakmgiylrngvllgvlvdpyaravevfrpgkpplrlegvervsldpelpgfal
    slpplw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wdjB (B:)
    mplvldlarpvseeelrrlselnpgyqwerspegrlwvsptggesgrrslqlayqlarwn
    eerglgvvfdsstgfkfpdgsilspdaafvergawealseaeregfpplapkavfevrsa
    sqdpeelrakmgiylrngvllgvlvdpyaravevfrpgkpplrlegvervsldpelpgfa
    lslpplw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wdjB (B:)
    lwvsptggesgrrslqlayqlarwneerglgvvfdsstgfkfpdgsilspdaafvergaw
    ealseaeregfpplapkavfevrsasqdpeelrakmgiylrngvllgvlvdpyaravevf
    rpgkpplrlegvervsldpelpgfalslpplw
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1wdjC (C:)
    mplvldlarpvseeelrrlselnpgyqwerspegrlwvsptggesgrrslqlayqlarwn
    eerglgvvfdsstgfkfpdgsilspdaafvergawealseaeregfpplapkavfevrsa
    sqdpeelrakmgiylrngvllgvlvdpyaravevfrpgkpplrlegvervsldpelpgfa
    lslpplw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wdjC (C:)
    plvldlarpvseeelrrlselnpgyqwerspegrlwvsptggesgrrslqlayqlarwne
    erglgvvfdsstgfkfpdgsilspdaafvergawealseaeregfpplapkavfevrsas
    qdpeelrakmgiylrngvllgvlvdpyaravevfrpgkpplrlegvervsldpelpgfal
    slpplw