PDB entry 1wdi

View 1wdi on RCSB PDB site
Description: Crystal Structure Of TT0907 From Thermus Thermophilus HB8
Class: Structural genomics, unknown function
Keywords: Structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, unknown function
Deposited on 2004-05-17, released 2004-11-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.237
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein TT0907
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wdia_
  • Heterogens: CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wdiA (A:)
    megleaydyhlppeqiaqegveprdmarlmvvyregpfrvahkrvrdlpeflrpgdvlvf
    neskviparllarkptggkveillvrerspglweallgparkappgtrllllspkdlapv
    pglqaevvaveedgvrllrfqgdlvahleevgevplppyikakipmeryqtvyarrpgsv
    aaptaglhftpellerlremgvelrfltlhvgpgtfrpvkgdpekhemhaepyaipeeva
    eavnrakaegrrvvavgttvvralesayregvgvvagegetrlfirppytfkvvdalftn
    fhlprstllmlvaaflgrertleayrlavaegyrfyslgdamlil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wdiA (A:)
    egleaydyhlppeqiaqegveprdmarlmvvyregpfrvahkrvrdlpeflrpgdvlvfn
    eskviparllarkptggkveillvrerallgparkappgtrllllspkdlapvpglqaev
    vaveedlvahleevgevpaaptaglhftpellerlremgvelrfltlhvgpgtfrpmhae
    pyaipeevaeavnrakaegrrvvavgttvvralesayregvgvvagegetrlfirppytf
    kvvdalftnfhlprstllmlvaaflgrertleayrlavaegyrfyslgdamlil