PDB entry 1wdh

View 1wdh on RCSB PDB site
Description: Crystal Structure Of Human Enolase-phosphatase E1
Class: hydrolase
Keywords: structure Human Enolase-phosphatase E1
Deposited on 2004-05-17, released 2005-05-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2005-06-21, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.208
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E-1 enzyme
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • GB NP_067027
      • modified residue (88)
      • modified residue (100)
      • modified residue (117)
      • modified residue (127)
      • modified residue (147)
    Domains in SCOPe 2.07: d1wdha_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wdhA (A:)
    mvvlsvpaevtvilldiegtttpiafvkdilfpyieenvkeylqthweeeecqqdvsllr
    kqaeedahldgavpipaasgngvddlqqmiqavvdnvcwqmsldrkttalkqlqghmwra
    aftagrmkaeffadvvpavrkwreagmkvyiyssgsveaqkllfghstegdilelvdghf
    dtkighkvesesyrkiadsigcstnnilfltdvtreasaaeeadvhvavvvrpgnagltd
    dektyyslitsfselylpsst
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wdhA (A:)
    lsvpaevtvilldiegtttpiafvkdilfpyieenvkeylqthweeeecqqdvsllrkqa
    eedahldgavpipaasgngvddlqqmiqavvdnvcwqmsldkttalkqlqghmwraafta
    grmkaeffadvvpavrkwreagmkvyiyssgsveaqkllfghstegdilelvdghfdtki
    ghkvesesyrkiadsigcstnnilfltdvtreasaaeeadvhvavvvrpgnagltddekt
    yyslitsfselyl