PDB entry 1wdg

View 1wdg on RCSB PDB site
Description: crystal structure of MHV spike protein fusion core
Class: viral protein
Keywords: MHV, coronavirus, heptad repeat, fusion core, viral entry, Viral protein
Deposited on 2004-05-14, released 2004-06-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-08-23, with a file datestamp of 2017-08-18.
Experiment type: XRAY
Resolution: 2.06 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: e2 glycoprotein
    Species: Murine hepatitis virus [TaxId:11142]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11224 (63-93)
      • linker (49)
    Domains in SCOPe 2.08: d1wdga_
  • Chain 'B':
    Compound: e2 glycoprotein
    Species: Murine hepatitis virus [TaxId:11142]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1wdgb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wdgA (A:)
    nqkmiasafnnalgaiqdgfdatnsalgkiqsvvnanaealnnllnqlslvprgsggsgg
    sgglnvtlldltyemnriqdaikklnesyinlke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wdgA (A:)
    nqkmiasafnnalgaiqdgfdatnsalgkiqsvvnanaealnnllnqlsllnvtlldlty
    emnriqdaikklnesyinlke
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wdgB (B:)
    nqkmiasafnnalgaiqdgfdatnsalgkiqsvvnanaealnnllnqlslvprgsggsgg
    sgglnvtlldltyemnriqdaikklnesyinlke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wdgB (B:)
    qkmiasafnnalgaiqdgfdatnsalgkiqsvvnanaealnnllnqlsldltyemnriqd
    aikklnesyinlke