PDB entry 1wdf

View 1wdf on RCSB PDB site
Description: crystal structure of MHV spike protein fusion core
Class: viral protein
Keywords: MHV, coronavirus, heptad repeat, fusion core, viral entry, Viral protein
Deposited on 2004-05-14, released 2004-06-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-16, with a file datestamp of 2017-08-11.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: e2 glycoprotein
    Species: Murine hepatitis virus [TaxId:11142]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wdfa_
  • Chain 'B':
    Compound: e2 glycoprotein
    Species: Murine hepatitis virus [TaxId:11142]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wdfb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wdfA (A:)
    nqkmiasafnnalgaiqdgfdatnsalgkiqsvvnanaealnnllnqlsnrfgaisdlsl
    dfeklnvtlldltyemnriqdaikklnesyinlke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wdfA (A:)
    qkmiasafnnalgaiqdgfdatnsalgkiqsvvnanaealnnllnqlsnrfgaidlsldf
    eklnvtlldltyemnriqdaikklnesyinl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wdfB (B:)
    nqkmiasafnnalgaiqdgfdatnsalgkiqsvvnanaealnnllnqlsnrfgaisdlsl
    dfeklnvtlldltyemnriqdaikklnesyinlke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wdfB (B:)
    nqkmiasafnnalgaiqdgfdatnsalgkiqsvvnanaealnnllnqlsnrfgadlsldf
    eklnvtlldltyemnriqdaikklnesyinlke