PDB entry 1wdc

View 1wdc on RCSB PDB site
Description: scallop myosin regulatory domain
Class: muscle protein
Keywords: myosin, calcium binding protein, muscle protein
Deposited on 1996-01-19, released 1996-07-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.194
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: scallop myosin
    Species: Argopecten irradians [TaxId:31199]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: scallop myosin
    Species: Argopecten irradians [TaxId:31199]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1wdcb_
  • Chain 'C':
    Compound: scallop myosin
    Species: Argopecten irradians [TaxId:31199]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1wdcc_
  • Heterogens: CA, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wdcB (B:)
    adkaasgvltklpqkqiqemkeafsmidvdrdgfvskedikaiseqlgrapddkeltaml
    keapgplnftmflsifsdklsgtdseetirnafamfdeqetkklnieyikdllenmgdnf
    nkdemrmtfkeapveggkfdyvkftamikgsgeeea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wdcB (B:)
    lpqkqiqemkeafsmidvdrdgfvskedikaiseqlgrapddkeltamlkeapgplnftm
    flsifsdklsgtdseetirnafamfdeqetkklnieyikdllenmgdnfnkdemrmtfke
    apveggkfdyvkftamikgsge
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1wdcC (C:)
    pklsqdeiddlkdvfelfdfwdgrdgavdafklgdvcrclginprnedvfavggthkmge
    kslpfeeflpayeglmdceqgtfadymeafktfdregqgfisgaelrhvltalgerlsde
    dvdeiikltdlqedlegnvkyedfvkkvmagpypdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wdcC (C:)
    lsqdeiddlkdvfelfdfwdgrdgavdafklgdvcrclginprnedvfavggthkmgeks
    lpfeeflpayeglmdceqgtfadymeafktfdregqgfisgaelrhvltalgerlsdedv
    deiikltdlqedlegnvkyedfvkkvmagpyp