PDB entry 1wdb

View 1wdb on RCSB PDB site
Description: nmr solution structure of bovine cytochrome b5, minimized average structure
Class: electron transport
Keywords: electron transport, transmembrane, b type cytochrome
Deposited on 1996-02-02, released 1997-01-11
The last revision prior to the SCOPe 2.07 freeze date was dated 1997-01-11, with a file datestamp of 2007-04-25.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome b5
    Species: BOS TAURUS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wdba_
  • Heterogens: HEM

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wdbA (A:)
    aeesskavkyytleeiqkhnnskstwlilhykvydltkfleehpggeevlreqaggdate
    nfedvghstdarelsktfiigelhpddrskitkpsesiittids
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wdbA (A:)
    skavkyytleeiqkhnnskstwlilhykvydltkfleehpggeevlreqaggdatenfed
    vghstdarelsktfiigelhpddr