PDB entry 1wd6

View 1wd6 on RCSB PDB site
Description: crystal structure of JW1657 from Escherichia coli
Class: structural genomics, unknown function
Keywords: hypothetical protein, STRUCTURAL GENOMICS, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2004-05-12, released 2004-11-12
The last revision prior to the SCOP 1.75 freeze date was dated 2004-11-12, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.208
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein ydhR
    Species: Escherichia coli
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ACX3
      • modified residue (35)
    Domains in SCOP 1.75: d1wd6a_
  • Chain 'B':
    Compound: Protein ydhR
    Species: Escherichia coli
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ACX3
      • modified residue (35)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wd6A (A:)
    mrgshhhhhhtdpalramatllqlhfafngpfgdamaeqlkplaesinqepgflwkvwte
    seknheaggiylftdeksalaylekhtarlknlgveevvakvfdvneplsqinqaklagl
    cgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wd6A (A:)
    atllqlhfafngpfgdamaeqlkplaesinqepgflwkvwteseknheaggiylftdeks
    alaylekhtarlknlgveevvakvfdvneplsqinqa
    

  • Chain 'B':
    No sequence available.