PDB entry 1wd5

View 1wd5 on RCSB PDB site
Description: Crystal structure of TT1426 from Thermus thermophilus HB8
Class: structural genomics, unknown function
Keywords: structural genomics, hypothetical protein, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2004-05-11, released 2004-11-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.195
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein TT1426
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1wd5a_
  • Heterogens: MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wd5A (A:)
    mrfrdrrhagallaealaplgleapvvlglprggvvvadevarrlggeldvvlvrkvgap
    gnpefalgavgeggelvlmpyalryadqsylereaarqrdvlrkraeryrrvrpkaarkg
    rdvvlvddgvatgasmeaalsvvfqegprrvvvavpvaspeaverlkaraevvalsvpqd
    faavgayyldfgevtdedveaillewag