PDB entry 1wd4

View 1wd4 on RCSB PDB site
Description: Crystal structure of arabinofuranosidase complexed with arabinose
Class: hydrolase
Keywords: beta-sandwich, beta-trefoil, complex with arabinose
Deposited on 2004-05-11, released 2004-09-14
The last revision prior to the SCOP 1.73 freeze date was dated 2006-01-24, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.07 Å
R-factor: 0.188
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-L-arabinofuranosidase B
    Species: Aspergillus kawachii
    Database cross-references and differences (RAF-indexed):
    • GB BAB96816 (1-481)
      • initiating methionine (0)
    Domains in SCOP 1.73: d1wd4a1, d1wd4a2
  • Heterogens: AHR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wd4A (A:)
    mgpcdiyeagdtpcvaahsttralyssfsgalyqlqrgsddttttispltaggiadasaq
    dtfcanttclitiiydqsgngnhltqappggfdgpdtdgydnlasaigapvtlngqkayg
    vfmspgtgyrnneatgtatgdeaegmyavldgthyndaccfdygnaetsstdtgaghmea
    iylgnsttwgygagdgpwimvdmennlfsgadegynsgdpsisyrfvtaavkggadkwai
    rganaasgslstyysgarpdysgynpmskegaiilgiggdnsngaqgtfyegvmtsgyps
    ddtensvqenivaakyvvgslvsgpsftsgevvslrvttpgyttryiahtdttvntqvvd
    ddssttlkeeaswtvvtglansqcfsfesvdtpgsyirhynfelllnandgtkqfhedat
    fcpqaalngegtslrswsyptryfrhyenvlyaasnggvqtfdsktsfnndvsfeietaf
    as