PDB entry 1wd3

View 1wd3 on RCSB PDB site
Description: crystal structure of arabinofuranosidase
Deposited on 2004-05-11, released 2004-09-14
The last revision prior to the SCOP 1.71 freeze date was dated 2004-09-14, with a file datestamp of 2004-09-14.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.191
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wd3A (A:)
    mgpcdiyeagdtpcvaahsttralyssfsgalyqlqrgsddttttispltaggiadasaq
    dtfcanttclitiiydqsgngnhltqappggfdgpdtdgydnlasaigapvtlngqkayg
    vfmspgtgyrnneatgtatgdeaegmyavldgthyndaccfdygnaetsstdtgaghmea
    iylgnsttwgygagdgpwimvdmennlfsgadegynsgdpsisyrfvtaavkggadkwai
    rganaasgslstyysgarpdysgynpmskegaiilgiggdnsngaqgtfyegvmtsgyps
    ddtensvqenivaakyvvgslvsgpsftsgevvslrvttpgyttryiahtdttvntqvvd
    ddssttlkeeaswtvvtglansqcfsfesvdtpgsyirhynfelllnandgtkqfhedat
    fcpqaalngegtslrswsyptryfrhyenvlyaasnggvqtfdsktsfnndvsfeietaf
    as