PDB entry 1wd1

View 1wd1 on RCSB PDB site
Description: Crystal structures of the hyperthermophilic chromosomal protein Sac7d in complex with DNA decamers
Class: structural protein/DNA
Keywords: PROTEIN-DNA COMPLEX, structural protein/DNA COMPLEX
Deposited on 2004-05-10, released 2004-08-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.248
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA-binding proteins 7a/7b/7d
    Species: Sulfolobus acidocaldarius [TaxId:2285]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1wd1a_
  • Chain 'B':
    Compound: 5'-d(*cp*cp*tp*ap*cp*gp*tp*ap*gp*g)-3'
  • Chain 'C':
    Compound: 5'-d(*cp*cp*tp*ap*cp*gp*tp*ap*gp*g)-3'
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1wd1A (A:)
mvkvkfkykgeekevdtskikkvwrvgkmvsftyddngktgrgavsekdapkelldmlar
aerekk

    Sequence, based on observed residues (ATOM records): (download) 
    >1wd1A (A:)
vkvkfkykgeekevdtskikkvwrvgkmvsftyddngktgrgavsekdapkelldmlara
erek

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.