PDB entry 1wd0

View 1wd0 on RCSB PDB site
Description: Crystal structures of the hyperthermophilic chromosomal protein Sac7d in complex with DNA decamers
Class: structural protein/DNA
Keywords: Protein-DNA complex, structural protein/DNA COMPLEX
Deposited on 2004-05-10, released 2004-08-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.221
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: DNA-binding proteins 7a/7b/7d
  Species: Sulfolobus acidocaldarius [TaxId:2285]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P13123 (0-65)
  Domains in SCOPe 2.07: d1wd0a_
• Chain 'B':
  Compound: 5'-d(*cp*cp*tp*ap*tp*ap*tp*ap*gp*g)-3'
  
• Chain 'C':
  Compound: 5'-d(*cp*cp*tp*ap*tp*ap*tp*ap*gp*g)-3'
  
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wd0A (A:)
  mvkvkfkykgeekevdtskikkvwrvgkmvsftyddngktgrgavsekdapkelldmlar
  aerekk
  

  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.