PDB entry 1wd0

View 1wd0 on RCSB PDB site
Description: Crystal structures of the hyperthermophilic chromosomal protein Sac7d in complex with DNA decamers
Class: structural protein/DNA
Keywords: Protein-DNA complex
Deposited on 2004-05-10, released 2004-08-03
The last revision prior to the SCOP 1.75 freeze date was dated 2004-08-03, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.221
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA-binding proteins 7a/7b/7d
    Species: Sulfolobus acidocaldarius
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1wd0a_
  • Chain 'B':
    Compound: 5'-d(*cp*cp*tp*ap*tp*ap*tp*ap*gp*g)-3'
  • Chain 'C':
    Compound: 5'-d(*cp*cp*tp*ap*tp*ap*tp*ap*gp*g)-3'
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wd0A (A:)
    mvkvkfkykgeekevdtskikkvwrvgkmvsftyddngktgrgavsekdapkelldmlar
    aerekk
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.