PDB entry 1wcy

View 1wcy on RCSB PDB site
Description: Crystal Structure Of Human Dipeptidyl Peptidase IV (DPPIV) Complex With Diprotin A
Class: hydrolase
Keywords: Serine protease, Dipeptidyl peptidase IV, CD26, Prolyl oligopeptidase, BETA-propeller structure, Diprotin A, HYDROLASE
Deposited on 2004-05-07, released 2005-05-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.224
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dipeptidyl peptidase IV
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wcya1, d1wcya2
  • Chain 'B':
    Compound: dipeptidyl peptidase IV
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wcyb1, d1wcyb2
  • Chain 'C':
    Compound: Diprotin A
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1WCY (0-2)
  • Chain 'D':
    Compound: Diprotin A
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1WCY (0-2)
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wcyA (A:)
    ddatadsrktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflen
    stfdefghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnnt
    qwvtwspvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsays
    alwwspngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvn
    tdslssvtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdyde
    ssgrwnclvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkk
    dctfitkgtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpe
    rcqyysvsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvqmpsk
    kldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatylasten
    iivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwgwsyg
    gyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstvmsra
    enfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstahqhiy
    thmshfikqcfslphhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wcyA (A:)
    dsrktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfde
    fghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtw
    spvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwws
    pngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdsls
    svtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrw
    nclvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfi
    tkgtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyy
    svsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvqmpskkldfi
    ilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatylasteniivas
    fdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwgwsyggyvts
    mvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstvmsraenfkq
    veyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstahqhiythmsh
    fikqcfslp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wcyB (B:)
    ddatadsrktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflen
    stfdefghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnnt
    qwvtwspvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsays
    alwwspngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvn
    tdslssvtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdyde
    ssgrwnclvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkk
    dctfitkgtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpe
    rcqyysvsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvqmpsk
    kldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatylasten
    iivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwgwsyg
    gyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstvmsra
    enfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstahqhiy
    thmshfikqcfslphhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wcyB (B:)
    dsrktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfde
    fghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtw
    spvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwws
    pngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdsls
    svtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrw
    nclvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfi
    tkgtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyy
    svsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvqmpskkldfi
    ilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatylasteniivas
    fdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwgwsyggyvts
    mvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstvmsraenfkq
    veyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstahqhiythmsh
    fikqcfslp
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.