PDB entry 1wcw

View 1wcw on RCSB PDB site
Description: Crystal Structure of Uroporphyrinogen III Synthase from an Extremely Thermophilic Bacterium Thermus thermophilus HB8 (Wild type, Native, Form-1 crystal)
Class: lyase
Keywords: UROPORPHYRINOGEN, PORPHYRIN, CONGENITAL ERYTHROPOIETIC PORPHYRIA, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, LYASE
Deposited on 2004-05-06, released 2005-05-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.188
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uroporphyrinogen III Synthase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SKH2 (9-260)
      • cloning artifact (7-8)
    Domains in SCOPe 2.07: d1wcwa1, d1wcwa2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wcwA (A:)
    mrrleedavrvayaglrrkeafkalaeklgftpllfpvqatekvpvpeyrdqvralaqgv
    dlflattgvgvrdlleagkalgldlegplakafrlargakaaralkeaglpphavgdgts
    ksllpllpqgrgvaalqlygkplpllenalaergyrvlplmpyrhlpdpegilrleeall
    rgevdalafvaaiqveflfegakdpkalrealntrvkalavgrvtadalrewgvkpfyvd
    eterlgsllqgfkralqkeva
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wcwA (A:)
    avrvayaglrrkeafkalaeklgftpllfpvqatekvpvpeyrdqvralaqgvdlflatt
    gvgvrdlleagkalgldlegplakafrlargakaaralkeaglpphavgdgtsksllpll
    pqgrgvaalqlygkplpllenalaergyrvlplmpyrhlpdpegilrleeallrgevdal
    afvaaiqveflfegakdpkalrealntrvkalavgrvtadalrewgvkpfyvdeterlgs
    llqgfkralqkeva