PDB entry 1wcv

View 1wcv on RCSB PDB site
Description: structure of the bacterial chromosome segregation protein soj
Class: chromosome segregation
Keywords: soj, ATPase, bacterial, chromosome segregation
Deposited on 2004-11-25, released 2005-01-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.2286
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: segregation protein
    Species: Thermus thermophilus [TaxId:262724]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wcv1_
  • Heterogens: CL, IOD, HOH

PDB Chain Sequences:

  • Chain '1':
    Sequence, based on SEQRES records: (download)
    >1wcv1 (1:)
    mlrakvrrialanqkggvgktttainlaaylarlgkrvllvdldpqgnatsglgvraerg
    vyhllqgepleglvhpvdgfhllpatpdlvgatvelagaptalrealrdegydlvlldap
    pslspltlnalaaaegvvvpvqaeyyalegvagllatleevraglnprlrllgilvtmyd
    grtllaqqveaqlrahfgekvfwtviprnvrlaeapsfgktiaqhaptspgahayrrlae
    evmarvqeagshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wcv1 (1:)
    kvrrialanqkggvgktttainlaaylarlgkrvllvdldpqgnatsglgvraergvyhl
    lqgepleglvhpvdgfhllpatpdlvgatvelagaptalrealrdegydlvlldappsls
    pltlnalaaaegvvvpvqaeyyalegvagllatleevraglnprlrllgilvtmydgrtl
    laqqveaqlrahfgekvfwtviprnvrlaeapsfgktiaqhaptspgahayrrlaeevma
    rvqe