PDB entry 1wcr

View 1wcr on RCSB PDB site
Description: trimeric structure of the enzyme iia from escherichia coli phosphotransferase system specific for n,n'-diacetylchitobiose
Class: transferase
Keywords: iia, pts, mutagenesis, chitobiose, transferase, sugar transport, phosphotransferase
Deposited on 2004-11-19, released 2005-01-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-13.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pts system, n, n'-diacetylchitobiose-specific iia component
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17335 (0-102)
      • engineered mutation (78)
    Domains in SCOPe 2.07: d1wcra_
  • Chain 'B':
    Compound: pts system, n, n'-diacetylchitobiose-specific iia component
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17335 (0-102)
      • engineered mutation (78)
    Domains in SCOPe 2.07: d1wcrb_
  • Chain 'C':
    Compound: pts system, n, n'-diacetylchitobiose-specific iia component
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17335 (0-102)
      • engineered mutation (78)
    Domains in SCOPe 2.07: d1wcrc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wcrA (A:)
    aeeleevvmgliinsgqarslayaalkqakqgdfaaakammdqsrmalneahlvqtklie
    gdagegkmkvslvlvhaqlhlmtsmlarelitelielheklka
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wcrB (B:)
    aeeleevvmgliinsgqarslayaalkqakqgdfaaakammdqsrmalneahlvqtklie
    gdagegkmkvslvlvhaqlhlmtsmlarelitelielheklka
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wcrC (C:)
    aeeleevvmgliinsgqarslayaalkqakqgdfaaakammdqsrmalneahlvqtklie
    gdagegkmkvslvlvhaqlhlmtsmlarelitelielheklka