PDB entry 1wcq

View 1wcq on RCSB PDB site
Description: mutagenesis of the nucleophilic tyrosine in a bacterial sialidase to phenylalanine.
Class: hydrolase
Keywords: hydrolase, sialidase, micromonospora viridifaciens, hydrolase neuraminidase, glycosidase
Deposited on 2004-11-19, released 2005-10-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.178
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sialidase
    Species: MICROMONOSPORA VIRIDIFACIENS [TaxId:1881]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02834 (0-600)
      • engineered mutation (323)
    Domains in SCOPe 2.07: d1wcqa1, d1wcqa2, d1wcqa3
  • Chain 'B':
    Compound: sialidase
    Species: MICROMONOSPORA VIRIDIFACIENS [TaxId:1881]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02834 (0-600)
      • engineered mutation (323)
    Domains in SCOPe 2.07: d1wcqb1, d1wcqb2, d1wcqb3
  • Chain 'C':
    Compound: sialidase
    Species: MICROMONOSPORA VIRIDIFACIENS [TaxId:1881]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02834 (Start-600)
      • engineered mutation (323)
    Domains in SCOPe 2.07: d1wcqc1, d1wcqc2, d1wcqc3
  • Heterogens: NA, GOL, DAN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wcqA (A:)
    geplyteqdlavngregfpnyripaltvtpdgdllasydgrptgidapgpnsilqrrstd
    ggrtwgeqqvvsagqttapikgfsdpsylvdretgtifnfhvysqrqgfagsrpgtdpad
    pnvlhanvatstdggltwshrtitaditpdpgwrsrfaasgegiqlrygphagrliqqyt
    iinaagafqavsvysddhgrtwrageavgvgmdenktvelsdgrvllnsrdsarsgyrkv
    avstdgghsygpvtidrdlpdptnnasiirafpdapagsarakvllfsnaasqtsrsqgt
    irmscddgqtwpvskvfqpgsmsfstltalpdgtygllyepgtgiryanfnlawlggica
    pftipdvalepgqqvtvpvavtnqsgiavpkpslqldaspdwqvqgsveplmpgrqakgq
    vtitvpagttpgryrvgatlrtsagnasttftvtvglldqarmsiadvdseetaredgra
    snvidgnpstfwhtewsradapgyphrisldlggthtisglqytrrqnsaneqvadyeiy
    tslngttwdgpvasgrfttslapqravfpardaryirlvalseqtghkyaavaelevegq
    r
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wcqB (B:)
    geplyteqdlavngregfpnyripaltvtpdgdllasydgrptgidapgpnsilqrrstd
    ggrtwgeqqvvsagqttapikgfsdpsylvdretgtifnfhvysqrqgfagsrpgtdpad
    pnvlhanvatstdggltwshrtitaditpdpgwrsrfaasgegiqlrygphagrliqqyt
    iinaagafqavsvysddhgrtwrageavgvgmdenktvelsdgrvllnsrdsarsgyrkv
    avstdgghsygpvtidrdlpdptnnasiirafpdapagsarakvllfsnaasqtsrsqgt
    irmscddgqtwpvskvfqpgsmsfstltalpdgtygllyepgtgiryanfnlawlggica
    pftipdvalepgqqvtvpvavtnqsgiavpkpslqldaspdwqvqgsveplmpgrqakgq
    vtitvpagttpgryrvgatlrtsagnasttftvtvglldqarmsiadvdseetaredgra
    snvidgnpstfwhtewsradapgyphrisldlggthtisglqytrrqnsaneqvadyeiy
    tslngttwdgpvasgrfttslapqravfpardaryirlvalseqtghkyaavaelevegq
    r
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1wcqC (C:)
    geplyteqdlavngregfpnyripaltvtpdgdllasydgrptgidapgpnsilqrrstd
    ggrtwgeqqvvsagqttapikgfsdpsylvdretgtifnfhvysqrqgfagsrpgtdpad
    pnvlhanvatstdggltwshrtitaditpdpgwrsrfaasgegiqlrygphagrliqqyt
    iinaagafqavsvysddhgrtwrageavgvgmdenktvelsdgrvllnsrdsarsgyrkv
    avstdgghsygpvtidrdlpdptnnasiirafpdapagsarakvllfsnaasqtsrsqgt
    irmscddgqtwpvskvfqpgsmsfstltalpdgtygllyepgtgiryanfnlawlggica
    pftipdvalepgqqvtvpvavtnqsgiavpkpslqldaspdwqvqgsveplmpgrqakgq
    vtitvpagttpgryrvgatlrtsagnasttftvtvglldqarmsiadvdseetaredgra
    snvidgnpstfwhtewsradapgyphrisldlggthtisglqytrrqnsaneqvadyeiy
    tslngttwdgpvasgrfttslapqravfpardaryirlvalseqtghkyaavaelevegq
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wcqC (C:)
    plyteqdlavngregfpnyripaltvtpdgdllasydgrptgidapgpnsilqrrstdgg
    rtwgeqqvvsagqttapikgfsdpsylvdretgtifnfhvysqrqgfagsrpgtdpadpn
    vlhanvatstdggltwshrtitaditpdpgwrsrfaasgegiqlrygphagrliqqytii
    naagafqavsvysddhgrtwrageavgvgmdenktvelsdgrvllnsrdsarsgyrkvav
    stdgghsygpvtidrdlpdptnnasiirafpdapagsarakvllfsnaasqtsrsqgtir
    mscddgqtwpvskvfqpgsmsfstltalpdgtygllyepgtgiryanfnlawlggicapf
    tipdvalepgqqvtvpvavtnqsgiavpkpslqldaspdwqvqgsveplmpgrqakgqvt
    itvpagttpgryrvgatlrtsagnasttftvtvglldqarmsiadvdseetaredgrasn
    vidgnpstfwhtewsradapgyphrisldlggthtisglqytrrqnsaneqvadyeiyts
    lngttwdgpvasgrfttslapqravfpardaryirlvalseqtghkyaavaelevegqr