PDB entry 1wcn

View 1wcn on RCSB PDB site
Description: nmr structure of the carboxyterminal domains of escherichia coli nusa
Deposited on 2004-11-18, released 2005-08-31
The last revision was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcription elongation protein nusA
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1wcnA (A:)
    gdnkpaddllnlegvdrdlafklaargvctledlaeqgiddladiegltdekagalimaa
    rnicwfgdea