PDB entry 1wcl

View 1wcl on RCSB PDB site
Description: nmr structure of the carboxyterminal domains of escherichia coli nusa
Class: RNA-binding protein
Keywords: RNA-binding protein, escherichia coli nusa, transcription regulation, regulation of RNA binding, transcription antitermination and termination, nmr, c-terminal repeat units
Deposited on 2004-11-17, released 2005-08-31
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcription elongation protein nusA
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1wcla1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wclA (A:)
    eahaaidtftkyldidedfatvlveegfstleelayvpmkelleiegldeptvealrera
    knalatiaqaqeeslg