PDB entry 1wcl

View 1wcl on RCSB PDB site
Description: NMR structure of the carboxyterminal domains of Escherichia coli NusA
Class: RNA-binding protein
Keywords: RNA-binding protein, escherichia coli nusa, transcription regulation, regulation of RNA binding, transcription antitermination and termination, c-terminal repeat units
Deposited on 2004-11-17, released 2005-08-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-04-19, with a file datestamp of 2017-04-14.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Transcription elongation protein nusA
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03003 (0-75)
  Domains in SCOPe 2.08: d1wcla_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wclA (A:)
  eahaaidtftkyldidedfatvlveegfstleelayvpmkelleiegldeptvealrera
  knalatiaqaqeeslg