PDB entry 1wcj

View 1wcj on RCSB PDB site
Description: conserved hypothetical protein tm0487 from thermotoga maritima
Class: structural genomics, unknown function
Keywords: structural genomics, unknown function, contains paad domain, similar to paad protein, unknown activity, alpha/beta fold, jcsg, hypothetical protein, psi, protein structure initiative, joint center for structural genomics
Deposited on 2004-11-17, released 2004-12-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hypothetical protein tm0487
  Species: Thermotoga maritima [TaxId:2336]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9WYV7 (Start-102)
  Domains in SCOPe 2.07: d1wcja_

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1wcjA (A:)
  pmskkvtkedvlnalknvidfelgldvvslglvydiqiddqnnvkvlmtmttpmcplagm
  ilsdaeeaikkiegvnnveveltfdppwtpermspelrekfgv
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1wcjA (A:)
  mskkvtkedvlnalknvidfelgldvvslglvydiqiddqnnvkvlmtmttpmcplagmi
  lsdaeeaikkiegvnnveveltfdppwtpermspelrekfgv