PDB entry 1wcj

View 1wcj on RCSB PDB site
Description: conserved hypothetical protein tm0487 from thermotoga maritima
Deposited on 2004-11-17, released 2004-12-14
The last revision prior to the SCOP 1.71 freeze date was dated 2004-12-14, with a file datestamp of 2004-12-14.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1wcja_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1wcjA (A:)
pmskkvtkedvlnalknvidfelgldvvslglvydiqiddqnnvkvlmtmttpmcplagm
ilsdaeeaikkiegvnnveveltfdppwtpermspelrekfgv

    Sequence, based on observed residues (ATOM records): (download) 
    >1wcjA (A:)
mskkvtkedvlnalknvidfelgldvvslglvydiqiddqnnvkvlmtmttpmcplagmi
lsdaeeaikkiegvnnveveltfdppwtpermspelrekfgv