PDB entry 1wci

View 1wci on RCSB PDB site
Description: reactivity modulation of human branched-chain alpha-ketoacid dehydrogenase by an internal molecular switch
Class: oxidoreductase
Keywords: oxidoreductase, ketoacid dehydrogenase, branched-chain, multi enzyme complex, acylation, oxidative decarboxylation, maple syrup urine disease, thiamine diphosphate, phosphorylation, conformational switch, reactivity, flavoprotein, maple syru urine disease, mitochondrion, thiamine
Deposited on 2004-11-16, released 2006-02-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.84 Å
R-factor: 0.149
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-oxoisovalerate dehydrogenase alpha subunit
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wcia_
  • Chain 'B':
    Compound: 2-oxoisovalerate dehydrogenase beta subunit
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wcib1, d1wcib2
  • Heterogens: CL, WWF, K, MN, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wciA (A:)
    sslddkpqfpgasaefidklefiqpnvisgipiyrvmdrqgqiinpsedphlpkekvlkl
    yksmtllntmdrilyesqrqgrisfymtnygeegthvgsaaaldntdlvfgqyreagvlm
    yrdyplelfmaqcygnisdlgkgrqmpvhygckerhfvtissplatqipqavgaayaakr
    ananrvvicyfgegaasegdahagfnfaatlecpiiffcrnngyaistptseqyrgdgia
    argpgygimsirvdgndvfavynatkearrravaenqpflieamtyrighhstsddssay
    rsvdevnywdkqdhpisrlrhyllsqgwwdeeqekawrkqsrrkvmeafeqaerkpkpnp
    nllfsdvyqempaqlrkqqeslarhlqtygehypldhfdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wciA (A:)
    kpqfpgasaefidklefiqpnvisgipiyrvmdrqgqiinpsedphlpkekvlklyksmt
    llntmdrilyesqrqgrisfymtnygeegthvgsaaaldntdlvfgqyreagvlmyrdyp
    lelfmaqcygnisdlgkgrqmpvhygckerhfvtissplatqipqavgaayaakrananr
    vvicyfgegaasegdahagfnfaatlecpiiffcrnngyaistptseqyrgdgiaargpg
    ygimsirvdgndvfavynatkearrravaenqpflieamtyrighhstsddssayrwdkq
    dhpisrlrhyllsqgwwdeeqekawrkqsrrkvmeafeqaerkpkpnpnllfsdvyqemp
    aqlrkqqeslarhlqtygehypldhfdk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wciB (B:)
    vahftfqpdpepreygqtqkmnlfqsvtsaldnslakdptavifgedvafggvfrctvgl
    rdkygkdrvfntplceqgivgfgigiavtgataiaeiqfadyifpafdqivneaakyryr
    sgdlfncgsltirspwgcvghgalyhsqspeaffahcpgikvviprspfqakglllscie
    dknpciffepkilyraaaeevpiepyniplsqaeviqegsdvtlvawgtqvhvirevasm
    akeklgvscevidlrtiipwdvdticksviktgrllisheapltggfaseisstvqeecf
    lnleapisrvcgydtpfphifepfyipdkwkcydalrkminy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wciB (B:)
    ahftfqeygqtqkmnlfqsvtsaldnslakdptavifgedvafggvfrctvglrdkygkd
    rvfntplceqgivgfgigiavtgataiaeiqfadyifpafdqivneaakyryrsgdlfnc
    gsltirspwgcvghgalyhsqspeaffahcpgikvviprspfqakglllsciedknpcif
    fepkilyraaaeevpiepyniplsqaeviqegsdvtlvawgtqvhvirevasmakeklgv
    scevidlrtiipwdvdticksviktgrllisheapltggfaseisstvqeecflnleapi
    srvcgydtpfphifepfyipdkwkcydalrkminy