PDB entry 1wcf

View 1wcf on RCSB PDB site
Description: 1.54 a crystal structure of rv3628, mycobacterium tuberculosis inorganic pyrophosphatase (ppase) at ph7.0
Class: hydrolase
Keywords: structural genomics, potassium, hydrolase
Deposited on 2004-11-13, released 2006-07-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-08-17, with a file datestamp of 2011-08-12.
Experiment type: XRAY
Resolution: 1.54 Å
R-factor: 0.157
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: inorganic pyrophosphatase
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P65746 (9-End)
      • expression tag (8)
    Domains in SCOPe 2.07: d1wcfa1, d1wcfa2
  • Heterogens: K, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wcfA (A:)
    msshhhhhhmqfdvtieipkgqrnkyevdhetgrvrldrylytpmayptdygfiedtlgd
    dgdpldalvllpqpvfpgvlvaarpvgmfrmvdehggddkvlcvpagdprwdhvqdigdv
    pafeldaikhffvhykdlepgkfvkaadwvdraeaeaevqrsverfkagth
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wcfA (A:)
    hmqfdvtieipkgqrnkyevdhetgrvrldrylytpmayptdygfiedtlgddgdpldal
    vllpqpvfpgvlvaarpvgmfrmvdehggddkvlcvpagdprwdhvqdigdvpafeldai
    khffvhykdlepgkfvkaadwvdraeaeaevqrsverfkagt