PDB entry 1wce

View 1wce on RCSB PDB site
Description: crystal structure of the t13 ibdv viral particle reveals a missing link in icosahedral viruses evolution
Deposited on 2004-11-12, released 2005-04-06
The last revision was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 7 Å
R-factor: N/A
AEROSPACI score: -0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: major structural protein vp2
    Species: INFECTIOUS BURSAL DISEASE VIRUS [TaxId:10995]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: major structural protein vp2
    Species: INFECTIOUS BURSAL DISEASE VIRUS [TaxId:10995]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: major structural protein vp2
    Species: INFECTIOUS BURSAL DISEASE VIRUS [TaxId:10995]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: major structural protein vp2
    Species: INFECTIOUS BURSAL DISEASE VIRUS [TaxId:10995]
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: major structural protein vp2
    Species: INFECTIOUS BURSAL DISEASE VIRUS [TaxId:10995]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: major structural protein vp2
    Species: INFECTIOUS BURSAL DISEASE VIRUS [TaxId:10995]
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: major structural protein vp2
    Species: INFECTIOUS BURSAL DISEASE VIRUS [TaxId:10995]
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: major structural protein vp2
    Species: INFECTIOUS BURSAL DISEASE VIRUS [TaxId:10995]
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: major structural protein vp2
    Species: INFECTIOUS BURSAL DISEASE VIRUS [TaxId:10995]
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: major structural protein vp2
    Species: INFECTIOUS BURSAL DISEASE VIRUS [TaxId:10995]
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: major structural protein vp2
    Species: INFECTIOUS BURSAL DISEASE VIRUS [TaxId:10995]
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: major structural protein vp2
    Species: INFECTIOUS BURSAL DISEASE VIRUS [TaxId:10995]
    Database cross-references and differences (RAF-indexed):
  • Chain 'M':
    Compound: major structural protein vp2
    Species: INFECTIOUS BURSAL DISEASE VIRUS [TaxId:10995]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1wceA (A:)
    mtnlqdqtqqivpfirsllmpttgpasipddtlekhtlrsetstynltvgdtgsglivff
    pgfpgsivgahytlqgngnykfdqmlltaqnlpasynycrlvsrsltvrsstlpggvyal
    ngtinavtfqgslseltdvsynglmsatanindkignvlvgegvtvlslptsydlgyvrl
    gdpipaigldpkmvatcdssdrprvytitaaddyqfssqyqpggvtitlfsanidaitsl
    svggelvfrtsvhglvlgvtiyligfdgttvitravaannglttgtdnlmpfnlviptne
    itqpitsikleivtsksggqagdqmswsargslavtihggnypgalrpvtlvayervatg
    svvtvagvsnfelipnpelaknlvteygrfdpgamnytklilserdrlgiktvwptreyt
    dfreyfmevadlnsplkiaga
    

    Sequence, based on observed residues (ATOM records):
    >1wceA (A:)
    pfirsllmpttgpasipddtlekhtlrsetstynltvgdtgsglivffpgfpgsivgahy
    tlqgngnykfdqmlltaqnlpasynycrlvsrsltvrsstlpggvyalngtinavtfqgs
    lseltdvsynglmsatanindkignvlvgegvtvlslptsydlgyvrlgdpipaigldpk
    mvatcdssdrprvytitaaddyqfssqyqpggvtitlfsanidaitslsvggelvfrtsv
    hglvlgvtiyligfdgttvitravaannglttgtdnlmpfnlviptneitqpitsiklei
    vtsksggqagdqmswsargslavtihggnypgalrpvtlvayervatgsvvtvagvsnfe
    lipnpelaknlvteygrfdpgamnytklilserdrlgiktvwptreytdfreyfmevadl
    nsplk
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1wceB (B:)
    mtnlqdqtqqivpfirsllmpttgpasipddtlekhtlrsetstynltvgdtgsglivff
    pgfpgsivgahytlqgngnykfdqmlltaqnlpasynycrlvsrsltvrsstlpggvyal
    ngtinavtfqgslseltdvsynglmsatanindkignvlvgegvtvlslptsydlgyvrl
    gdpipaigldpkmvatcdssdrprvytitaaddyqfssqyqpggvtitlfsanidaitsl
    svggelvfrtsvhglvlgvtiyligfdgttvitravaannglttgtdnlmpfnlviptne
    itqpitsikleivtsksggqagdqmswsargslavtihggnypgalrpvtlvayervatg
    svvtvagvsnfelipnpelaknlvteygrfdpgamnytklilserdrlgiktvwptreyt
    dfreyfmevadlnsplkiaga
    

    Sequence, based on observed residues (ATOM records):
    >1wceB (B:)
    vpfirsllmpttgpasipddtlekhtlrsetstynltvgdtgsglivffpgfpgsivgah
    ytlqgngnykfdqmlltaqnlpasynycrlvsrsltvrsstlpggvyalngtinavtfqg
    slseltdvsynglmsatanindkignvlvgegvtvlslptsydlgyvrlgdpipaigldp
    kmvatcdssdrprvytitaaddyqfssqyqpggvtitlfsanidaitslsvggelvfrts
    vhglvlgvtiyligfdgttvitravaannglttgtdnlmpfnlviptneitqpitsikle
    ivtsksggqagdqmswsargslavtihggnypgalrpvtlvayervatgsvvtvagvsnf
    elipnpelaknlvteygrfdpgamnytklilserdrlgiktvwptreytdfreyfmevad
    lnsplkiaga
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >1wceC (C:)
    mtnlqdqtqqivpfirsllmpttgpasipddtlekhtlrsetstynltvgdtgsglivff
    pgfpgsivgahytlqgngnykfdqmlltaqnlpasynycrlvsrsltvrsstlpggvyal
    ngtinavtfqgslseltdvsynglmsatanindkignvlvgegvtvlslptsydlgyvrl
    gdpipaigldpkmvatcdssdrprvytitaaddyqfssqyqpggvtitlfsanidaitsl
    svggelvfrtsvhglvlgvtiyligfdgttvitravaannglttgtdnlmpfnlviptne
    itqpitsikleivtsksggqagdqmswsargslavtihggnypgalrpvtlvayervatg
    svvtvagvsnfelipnpelaknlvteygrfdpgamnytklilserdrlgiktvwptreyt
    dfreyfmevadlnsplkiaga
    

    Sequence, based on observed residues (ATOM records):
    >1wceC (C:)
    vpfirsllmpttgpasipddtlekhtlrsetstynltvgdtgsglivffpgfpgsivgah
    ytlqgngnykfdqmlltaqnlpasynycrlvsrsltvrsstlpggvyalngtinavtfqg
    slseltdvsynglmsatanindkignvlvgegvtvlslptsydlgyvrlgdpipaigldp
    kmvatcdssdrprvytitaaddyqfssqyqpggvtitlfsanidaitslsvggelvfrts
    vhglvlgvtiyligfdgttvitravaannglttgtdnlmpfnlviptneitqpitsikle
    ivtsksggqagdqmswsargslavtihggnypgalrpvtlvayervatgsvvtvagvsnf
    elipnpelaknlvteygrfdpgamnytklilserdrlgiktvwptreytdfreyfmevad
    lnsplkiaga
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >1wceD (D:)
    mtnlqdqtqqivpfirsllmpttgpasipddtlekhtlrsetstynltvgdtgsglivff
    pgfpgsivgahytlqgngnykfdqmlltaqnlpasynycrlvsrsltvrsstlpggvyal
    ngtinavtfqgslseltdvsynglmsatanindkignvlvgegvtvlslptsydlgyvrl
    gdpipaigldpkmvatcdssdrprvytitaaddyqfssqyqpggvtitlfsanidaitsl
    svggelvfrtsvhglvlgvtiyligfdgttvitravaannglttgtdnlmpfnlviptne
    itqpitsikleivtsksggqagdqmswsargslavtihggnypgalrpvtlvayervatg
    svvtvagvsnfelipnpelaknlvteygrfdpgamnytklilserdrlgiktvwptreyt
    dfreyfmevadlnsplkiaga
    

    Sequence, based on observed residues (ATOM records):
    >1wceD (D:)
    pfirsllmpttgpasipddtlekhtlrsetstynltvgdtgsglivffpgfpgsivgahy
    tlqgngnykfdqmlltaqnlpasynycrlvsrsltvrsstlpggvyalngtinavtfqgs
    lseltdvsynglmsatanindkignvlvgegvtvlslptsydlgyvrlgdpipaigldpk
    mvatcdssdrprvytitaaddyqfssqyqpggvtitlfsanidaitslsvggelvfrtsv
    hglvlgvtiyligfdgttvitravaannglttgtdnlmpfnlviptneitqpitsiklei
    vtsksggqagdqmswsargslavtihggnypgalrpvtlvayervatgsvvtvagvsnfe
    lipnpelaknlvteygrfdpgamnytklilserdrlgiktvwptreytdfreyfmevadl
    nspl
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >1wceE (E:)
    mtnlqdqtqqivpfirsllmpttgpasipddtlekhtlrsetstynltvgdtgsglivff
    pgfpgsivgahytlqgngnykfdqmlltaqnlpasynycrlvsrsltvrsstlpggvyal
    ngtinavtfqgslseltdvsynglmsatanindkignvlvgegvtvlslptsydlgyvrl
    gdpipaigldpkmvatcdssdrprvytitaaddyqfssqyqpggvtitlfsanidaitsl
    svggelvfrtsvhglvlgvtiyligfdgttvitravaannglttgtdnlmpfnlviptne
    itqpitsikleivtsksggqagdqmswsargslavtihggnypgalrpvtlvayervatg
    svvtvagvsnfelipnpelaknlvteygrfdpgamnytklilserdrlgiktvwptreyt
    dfreyfmevadlnsplkiaga
    

    Sequence, based on observed residues (ATOM records):
    >1wceE (E:)
    pfirsllmpttgpasipddtlekhtlrsetstynltvgdtgsglivffpgfpgsivgahy
    tlqgngnykfdqmlltaqnlpasynycrlvsrsltvrsstlpggvyalngtinavtfqgs
    lseltdvsynglmsatanindkignvlvgegvtvlslptsydlgyvrlgdpipaigldpk
    mvatcdssdrprvytitaaddyqfssqyqpggvtitlfsanidaitslsvggelvfrtsv
    hglvlgvtiyligfdgttvitravaannglttgtdnlmpfnlviptneitqpitsiklei
    vtsksggqagdqmswsargslavtihggnypgalrpvtlvayervatgsvvtvagvsnfe
    lipnpelaknlvteygrfdpgamnytklilserdrlgiktvwptreytdfreyfmevadl
    nsplkiaga
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >1wceF (F:)
    mtnlqdqtqqivpfirsllmpttgpasipddtlekhtlrsetstynltvgdtgsglivff
    pgfpgsivgahytlqgngnykfdqmlltaqnlpasynycrlvsrsltvrsstlpggvyal
    ngtinavtfqgslseltdvsynglmsatanindkignvlvgegvtvlslptsydlgyvrl
    gdpipaigldpkmvatcdssdrprvytitaaddyqfssqyqpggvtitlfsanidaitsl
    svggelvfrtsvhglvlgvtiyligfdgttvitravaannglttgtdnlmpfnlviptne
    itqpitsikleivtsksggqagdqmswsargslavtihggnypgalrpvtlvayervatg
    svvtvagvsnfelipnpelaknlvteygrfdpgamnytklilserdrlgiktvwptreyt
    dfreyfmevadlnsplkiaga
    

    Sequence, based on observed residues (ATOM records):
    >1wceF (F:)
    mtnlqdqtqqivpfirsllmpttgpasipddtlekhtlrsetstynltvgdtgsglivff
    pgfpgsivgahytlqgngnykfdqmlltaqnlpasynycrlvsrsltvrsstlpggvyal
    ngtinavtfqgslseltdvsynglmsatanindkignvlvgegvtvlslptsydlgyvrl
    gdpipaigldpkmvatcdssdrprvytitaaddyqfssqyqpggvtitlfsanidaitsl
    svggelvfrtsvhglvlgvtiyligfdgttvitravaannglttgtdnlmpfnlviptne
    itqpitsikleivtsksggqagdqmswsargslavtihggnypgalrpvtlvayervatg
    svvtvagvsnfelipnpelaknlvteygrfdpgamnytklilserdrlgiktvwptreyt
    dfreyfmevadlnspl
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >1wceG (G:)
    mtnlqdqtqqivpfirsllmpttgpasipddtlekhtlrsetstynltvgdtgsglivff
    pgfpgsivgahytlqgngnykfdqmlltaqnlpasynycrlvsrsltvrsstlpggvyal
    ngtinavtfqgslseltdvsynglmsatanindkignvlvgegvtvlslptsydlgyvrl
    gdpipaigldpkmvatcdssdrprvytitaaddyqfssqyqpggvtitlfsanidaitsl
    svggelvfrtsvhglvlgvtiyligfdgttvitravaannglttgtdnlmpfnlviptne
    itqpitsikleivtsksggqagdqmswsargslavtihggnypgalrpvtlvayervatg
    svvtvagvsnfelipnpelaknlvteygrfdpgamnytklilserdrlgiktvwptreyt
    dfreyfmevadlnsplkiaga
    

    Sequence, based on observed residues (ATOM records):
    >1wceG (G:)
    vpfirsllmpttgpasipddtlekhtlrsetstynltvgdtgsglivffpgfpgsivgah
    ytlqgngnykfdqmlltaqnlpasynycrlvsrsltvrsstlpggvyalngtinavtfqg
    slseltdvsynglmsatanindkignvlvgegvtvlslptsydlgyvrlgdpipaigldp
    kmvatcdssdrprvytitaaddyqfssqyqpggvtitlfsanidaitslsvggelvfrts
    vhglvlgvtiyligfdgttvitravaannglttgtdnlmpfnlviptneitqpitsikle
    ivtsksggqagdqmswsargslavtihggnypgalrpvtlvayervatgsvvtvagvsnf
    elipnpelaknlvteygrfdpgamnytklilserdrlgiktvwptreytdfreyfmevad
    lnsplk
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >1wceH (H:)
    mtnlqdqtqqivpfirsllmpttgpasipddtlekhtlrsetstynltvgdtgsglivff
    pgfpgsivgahytlqgngnykfdqmlltaqnlpasynycrlvsrsltvrsstlpggvyal
    ngtinavtfqgslseltdvsynglmsatanindkignvlvgegvtvlslptsydlgyvrl
    gdpipaigldpkmvatcdssdrprvytitaaddyqfssqyqpggvtitlfsanidaitsl
    svggelvfrtsvhglvlgvtiyligfdgttvitravaannglttgtdnlmpfnlviptne
    itqpitsikleivtsksggqagdqmswsargslavtihggnypgalrpvtlvayervatg
    svvtvagvsnfelipnpelaknlvteygrfdpgamnytklilserdrlgiktvwptreyt
    dfreyfmevadlnsplkiaga
    

    Sequence, based on observed residues (ATOM records):
    >1wceH (H:)
    pfirsllmpttgpasipddtlekhtlrsetstynltvgdtgsglivffpgfpgsivgahy
    tlqgngnykfdqmlltaqnlpasynycrlvsrsltvrsstlpggvyalngtinavtfqgs
    lseltdvsynglmsatanindkignvlvgegvtvlslptsydlgyvrlgdpipaigldpk
    mvatcdssdrprvytitaaddyqfssqyqpggvtitlfsanidaitslsvggelvfrtsv
    hglvlgvtiyligfdgttvitravaannglttgtdnlmpfnlviptneitqpitsiklei
    vtsksggqagdqmswsargslavtihggnypgalrpvtlvayervatgsvvtvagvsnfe
    lipnpelaknlvteygrfdpgamnytklilserdrlgiktvwptreytdfreyfmevadl
    nsp
    

  • Chain 'I':
    Sequence, based on SEQRES records:
    >1wceI (I:)
    mtnlqdqtqqivpfirsllmpttgpasipddtlekhtlrsetstynltvgdtgsglivff
    pgfpgsivgahytlqgngnykfdqmlltaqnlpasynycrlvsrsltvrsstlpggvyal
    ngtinavtfqgslseltdvsynglmsatanindkignvlvgegvtvlslptsydlgyvrl
    gdpipaigldpkmvatcdssdrprvytitaaddyqfssqyqpggvtitlfsanidaitsl
    svggelvfrtsvhglvlgvtiyligfdgttvitravaannglttgtdnlmpfnlviptne
    itqpitsikleivtsksggqagdqmswsargslavtihggnypgalrpvtlvayervatg
    svvtvagvsnfelipnpelaknlvteygrfdpgamnytklilserdrlgiktvwptreyt
    dfreyfmevadlnsplkiaga
    

    Sequence, based on observed residues (ATOM records):
    >1wceI (I:)
    vpfirsllmpttgpasipddtlekhtlrsetstynltvgdtgsglivffpgfpgsivgah
    ytlqgngnykfdqmlltaqnlpasynycrlvsrsltvrsstlpggvyalngtinavtfqg
    slseltdvsynglmsatanindkignvlvgegvtvlslptsydlgyvrlgdpipaigldp
    kmvatcdssdrprvytitaaddyqfssqyqpggvtitlfsanidaitslsvggelvfrts
    vhglvlgvtiyligfdgttvitravaannglttgtdnlmpfnlviptneitqpitsikle
    ivtsksggqagdqmswsargslavtihggnypgalrpvtlvayervatgsvvtvagvsnf
    elipnpelaknlvteygrfdpgamnytklilserdrlgiktvwptreytdfreyfme
    

  • Chain 'J':
    Sequence, based on SEQRES records:
    >1wceJ (J:)
    mtnlqdqtqqivpfirsllmpttgpasipddtlekhtlrsetstynltvgdtgsglivff
    pgfpgsivgahytlqgngnykfdqmlltaqnlpasynycrlvsrsltvrsstlpggvyal
    ngtinavtfqgslseltdvsynglmsatanindkignvlvgegvtvlslptsydlgyvrl
    gdpipaigldpkmvatcdssdrprvytitaaddyqfssqyqpggvtitlfsanidaitsl
    svggelvfrtsvhglvlgvtiyligfdgttvitravaannglttgtdnlmpfnlviptne
    itqpitsikleivtsksggqagdqmswsargslavtihggnypgalrpvtlvayervatg
    svvtvagvsnfelipnpelaknlvteygrfdpgamnytklilserdrlgiktvwptreyt
    dfreyfmevadlnsplkiaga
    

    Sequence, based on observed residues (ATOM records):
    >1wceJ (J:)
    vpfirsllmpttgpasipddtlekhtlrsetstynltvgdtgsglivffpgfpgsivgah
    ytlqgngnykfdqmlltaqnlpasynycrlvsrsltvrsstlpggvyalngtinavtfqg
    slseltdvsynglmsatanindkignvlvgegvtvlslptsydlgyvrlgdpipaigldp
    kmvatcdssdrprvytitaaddyqfssqyqpggvtitlfsanidaitslsvggelvfrts
    vhglvlgvtiyligfdgttvitravaannglttgtdnlmpfnlviptneitqpitsikle
    ivtsksggqagdqmswsargslavtihggnypgalrpvtlvayervatgsvvtvagvsnf
    elipnpelaknlvteygrfdpgamnytklilserdrlgiktvwptreytdfreyfmevad
    lns
    

  • Chain 'K':
    Sequence, based on SEQRES records:
    >1wceK (K:)
    mtnlqdqtqqivpfirsllmpttgpasipddtlekhtlrsetstynltvgdtgsglivff
    pgfpgsivgahytlqgngnykfdqmlltaqnlpasynycrlvsrsltvrsstlpggvyal
    ngtinavtfqgslseltdvsynglmsatanindkignvlvgegvtvlslptsydlgyvrl
    gdpipaigldpkmvatcdssdrprvytitaaddyqfssqyqpggvtitlfsanidaitsl
    svggelvfrtsvhglvlgvtiyligfdgttvitravaannglttgtdnlmpfnlviptne
    itqpitsikleivtsksggqagdqmswsargslavtihggnypgalrpvtlvayervatg
    svvtvagvsnfelipnpelaknlvteygrfdpgamnytklilserdrlgiktvwptreyt
    dfreyfmevadlnsplkiaga
    

    Sequence, based on observed residues (ATOM records):
    >1wceK (K:)
    pfirsllmpttgpasipddtlekhtlrsetstynltvgdtgsglivffpgfpgsivgahy
    tlqgngnykfdqmlltaqnlpasynycrlvsrsltvrsstlpggvyalngtinavtfqgs
    lseltdvsynglmsatanindkignvlvgegvtvlslptsydlgyvrlgdpipaigldpk
    mvatcdssdrprvytitaaddyqfssqyqpggvtitlfsanidaitslsvggelvfrtsv
    hglvlgvtiyligfdgttvitravaannglttgtdnlmpfnlviptneitqpitsiklei
    vtsksggqagdqmswsargslavtihggnypgalrpvtlvayervatgsvvtvagvsnfe
    lipnpelaknlvteygrfdpgamnytklilserdrlgiktvwptreytdfreyfme
    

  • Chain 'L':
    Sequence, based on SEQRES records:
    >1wceL (L:)
    mtnlqdqtqqivpfirsllmpttgpasipddtlekhtlrsetstynltvgdtgsglivff
    pgfpgsivgahytlqgngnykfdqmlltaqnlpasynycrlvsrsltvrsstlpggvyal
    ngtinavtfqgslseltdvsynglmsatanindkignvlvgegvtvlslptsydlgyvrl
    gdpipaigldpkmvatcdssdrprvytitaaddyqfssqyqpggvtitlfsanidaitsl
    svggelvfrtsvhglvlgvtiyligfdgttvitravaannglttgtdnlmpfnlviptne
    itqpitsikleivtsksggqagdqmswsargslavtihggnypgalrpvtlvayervatg
    svvtvagvsnfelipnpelaknlvteygrfdpgamnytklilserdrlgiktvwptreyt
    dfreyfmevadlnsplkiaga
    

    Sequence, based on observed residues (ATOM records):
    >1wceL (L:)
    pfirsllmpttgpasipddtlekhtlrsetstynltvgdtgsglivffpgfpgsivgahy
    tlqgngnykfdqmlltaqnlpasynycrlvsrsltvrsstlpggvyalngtinavtfqgs
    lseltdvsynglmsatanindkignvlvgegvtvlslptsydlgyvrlgdpipaigldpk
    mvatcdssdrprvytitaaddyqfssqyqpggvtitlfsanidaitslsvggelvfrtsv
    hglvlgvtiyligfdgttvitravaannglttgtdnlmpfnlviptneitqpitsiklei
    vtsksggqagdqmswsargslavtihggnypgalrpvtlvayervatgsvvtvagvsnfe
    lipnpelaknlvteygrfdpgamnytklilserdrlgiktvwptreytdfreyfmevadl
    nsplkiaga
    

  • Chain 'M':
    Sequence, based on SEQRES records:
    >1wceM (M:)
    mtnlqdqtqqivpfirsllmpttgpasipddtlekhtlrsetstynltvgdtgsglivff
    pgfpgsivgahytlqgngnykfdqmlltaqnlpasynycrlvsrsltvrsstlpggvyal
    ngtinavtfqgslseltdvsynglmsatanindkignvlvgegvtvlslptsydlgyvrl
    gdpipaigldpkmvatcdssdrprvytitaaddyqfssqyqpggvtitlfsanidaitsl
    svggelvfrtsvhglvlgvtiyligfdgttvitravaannglttgtdnlmpfnlviptne
    itqpitsikleivtsksggqagdqmswsargslavtihggnypgalrpvtlvayervatg
    svvtvagvsnfelipnpelaknlvteygrfdpgamnytklilserdrlgiktvwptreyt
    dfreyfmevadlnsplkiaga
    

    Sequence, based on observed residues (ATOM records):
    >1wceM (M:)
    pfirsllmpttgpasipddtlekhtlrsetstynltvgdtgsglivffpgfpgsivgahy
    tlqgngnykfdqmlltaqnlpasynycrlvsrsltvrsstlpggvyalngtinavtfqgs
    lseltdvsynglmsatanindkignvlvgegvtvlslptsydlgyvrlgdpipaigldpk
    mvatcdssdrprvytitaaddyqfssqyqpggvtitlfsanidaitslsvggelvfrtsv
    hglvlgvtiyligfdgttvitravaannglttgtdnlmpfnlviptneitqpitsiklei
    vtsksggqagdqmswsargslavtihggnypgalrpvtlvayervatgsvvtvagvsnfe
    lipnpelaknlvteygrfdpgamnytklilserdrlgiktvwptreytdfreyfmevadl
    nspla